DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and DLG2

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_016872743.1 Gene:DLG2 / 1740 HGNCID:2901 Length:1039 Species:Homo sapiens


Alignment Length:189 Identity:63/189 - (33%)
Similarity:101/189 - (53%) Gaps:18/189 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFV-ERPEMEAAIAGD 99
            ||:::.||.   |..:...|.:|||..||..:.||||..|:.|..|..|:|| .|.:||..|...
Human   850 RPVIILGPM---KDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEH 911

  Fly   100 EFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIK---EL 161
            :|||..::..||||||..:||.:..:|:.||||:....:::::...|.||.||..|.|::   |:
Human   912 KFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEM 976

  Fly   162 ERRLRKRGSETEESLSKRLN-AAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQE 219
            .:||      |||...|..: |.::|.::|   ..|..|:....::..|.:.: .|::|
Human   977 NKRL------TEEQAKKTYDRAIKLEQEFG---EYFTAIVQGDTLEDIYNQCK-LVIEE 1025

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 62/187 (33%)
guanyl_kin 36..216 CDD:213788 61/184 (33%)
DLG2XP_016872743.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.