DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Card14

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_006532429.1 Gene:Card14 / 170720 MGIID:2386258 Length:1029 Species:Mus musculus


Alignment Length:131 Identity:31/131 - (23%)
Similarity:55/131 - (41%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 EFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIF--NNPPSIKELE 162
            :.|:..|..|:.:..::.||..:.......:||:....|..:.|.|:.||:|.  .|..:.|:|.
Mouse   898 DIIQEGESIGDHHWITRHAVESLMNMSTHALLDVRLDSVRVLHRMDMFPIIIHVSVNEKTAKKLR 962

  Fly   163 RRLRKRGSETEESLSKRLNAAQVELD------YGLTPGNFHKIINNVDIDVAYEEFRNFVVQELK 221
            :.|.:.|| :||...:.....:.|||      ..|.|.::.      |:|......|..:..|.|
Mouse   963 KGLHRLGS-SEEQFLEVARQEEGELDRVPCLYSSLAPDSWS------DLDSLLSCVRLAIADEQK 1020

  Fly   222 E 222
            :
Mouse  1021 K 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 29/126 (23%)
guanyl_kin 36..216 CDD:213788 29/123 (24%)
Card14XP_006532429.1 DD 19..104 CDD:387368
Smc <132..410 CDD:224117
PDZ_signaling 587..659 CDD:238492
SH3 684..745 CDD:388381
NK <884..1008 CDD:388413 28/116 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.