Sequence 1: | NP_648408.1 | Gene: | CG11811 / 39213 | FlyBaseID: | FBgn0036099 | Length: | 233 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001352629.1 | Gene: | LRGUK / 136332 | HGNCID: | 21964 | Length: | 1131 | Species: | Homo sapiens |
Alignment Length: | 221 | Identity: | 64/221 - (28%) |
---|---|---|---|
Similarity: | 103/221 - (46%) | Gaps: | 19/221 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 IVNRALSSSSSSSSAAASLTSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTT 71
Fly 72 RKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQK 136
Fly 137 GVEQIKRTDLNPILIFNNPPSIKELERRLRKRG----SETEESLSKRLNAAQVELDYGLT---PG 194
Fly 195 NFHKIINNVDIDVAYEEFRNFVVQEL 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11811 | NP_648408.1 | Guanylate_kin | 34..219 | CDD:279019 | 56/191 (29%) |
guanyl_kin | 36..216 | CDD:213788 | 55/186 (30%) | ||
LRGUK | NP_001352629.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 73..96 | ||
LRR 1 | 129..149 | ||||
leucine-rich repeat | 131..150 | CDD:275380 | |||
LRR | <150..>337 | CDD:227223 | |||
LRR 2 | 150..171 | ||||
leucine-rich repeat | 151..172 | CDD:275380 | |||
LRR 3 | 172..193 | ||||
leucine-rich repeat | 173..194 | CDD:275380 | |||
LRR 4 | 194..215 | ||||
leucine-rich repeat | 195..216 | CDD:275380 | |||
LRR 5 | 216..237 | ||||
leucine-rich repeat | 217..238 | CDD:275380 | |||
LRR 6 | 238..259 | ||||
leucine-rich repeat | 258..281 | CDD:275380 | |||
LRR 7 | 260..280 | ||||
LRR 8 | 281..302 | ||||
leucine-rich repeat | 282..300 | CDD:275380 | |||
LRR 9 | 303..324 | ||||
leucine-rich repeat | 304..328 | CDD:275380 | |||
GMPK | 416..592 | CDD:238026 | 55/182 (30%) | ||
Atrophin-1 | <784..1126 | CDD:331285 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0194 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |