DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Dlg4

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001357604.1 Gene:Dlg4 / 13385 MGIID:1277959 Length:764 Species:Mus musculus


Alignment Length:215 Identity:72/215 - (33%)
Similarity:109/215 - (50%) Gaps:20/215 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SSSSSSSAAASL----TSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKP 74
            |||.|.....|:    |..:|.....||:::.||:   |......|.:|||..||..:.||||..
Mouse   549 SSSGSQGREDSVLSYETVTQMEVHYARPIIILGPT---KDRANDDLLSEFPDKFGSCVPHTTRPK 610

  Fly    75 REGEEHGVHYYFV-ERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGV 138
            ||.|..|..|:|| .|.:||..|...:|||..::..:|||||..:|||:..||:.||||:....|
Mouse   611 REYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAV 675

  Fly   139 EQIKRTDLNPILIFNNPPSIK---ELERRLRKRGSETEESLSKRLNAAQVELDYGLTPGNFHKII 200
            .:::...|:||.||..|.|::   |:.:|:      |||...|..:.| .:|:...|. .|..|:
Mouse   676 RRLQAAHLHPIAIFIRPRSLENVLEINKRI------TEEQARKAFDRA-TKLEQEFTE-CFSAIV 732

  Fly   201 NNVDIDVAYEEFRNFVVQEL 220
            .....:..|.:.:. |:::|
Mouse   733 EGDSFEEIYHKVKR-VIEDL 751

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 64/188 (34%)
guanyl_kin 36..216 CDD:213788 63/183 (34%)
Dlg4NP_001357604.1 L27 <26..47 CDD:351851
MAGUK_N_PEST 54..104 CDD:337803
PDZ 105..189 CDD:334167
PDZ 197..287 CDD:214570
PDZ_assoc 285..352 CDD:313755
PDZ 350..434 CDD:214570
SH3_DLG4 470..535 CDD:212963
Guanylate_kin 573..751 CDD:279019 64/189 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.