DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Mpp3

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_031889.2 Gene:Mpp3 / 13384 MGIID:1328354 Length:585 Species:Mus musculus


Alignment Length:157 Identity:54/157 - (34%)
Similarity:88/157 - (56%) Gaps:5/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PGPRP--LVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAA 95
            ||.||  :||.|..|:....|.:|:.||.|..|..::.||||..:..|..||.|:||.:...||.
Mouse   381 PGERPRLVVLIGSLGAHLHELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEAD 445

  Fly    96 IAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKE 160
            :..::|:|..|:..||||||..|::.:.|:.:||::|:|.:.:..::..:..|.:||.. |:|: 
Mouse   446 VHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVK-PAIQ- 508

  Fly   161 LERRLRKRGSETEESLSKRLNAAQVEL 187
             |||.....|...|.::..|:..|.|:
Mouse   509 -ERRKTPPVSPDSEDIASSLDEQQQEM 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 53/156 (34%)
guanyl_kin 36..216 CDD:213788 52/154 (34%)
Mpp3NP_031889.2 L27 12..64 CDD:197794
L27 71..121 CDD:197794
PDZ_signaling 135..215 CDD:238492
SH3_MPP3 230..291 CDD:212972
GuKc 395..570 CDD:214504 47/143 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.