DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and Cask

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_011245733.1 Gene:Cask / 12361 MGIID:1309489 Length:972 Species:Mus musculus


Alignment Length:227 Identity:60/227 - (26%)
Similarity:93/227 - (40%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEME 93
            |:.|...:.|||.|..|.|:..:...|..:.|..|.:.|.||||.|::.||:|.:||||...:|.
Mouse   739 KLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMM 803

  Fly    94 AAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQ------------------ 140
            ..|:.:|::|.......:|||....:|:|..||.:.|||:|.:|:|:                  
Mouse   804 QDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQGLEKSSGQGWLEAKSQSWSWSS 868

  Fly   141 ----------------------IKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAA 183
                                  ::..:..|.::|...|:|..        |...:|||.:    .
Mouse   869 TSSPWVPHWSSPERRFLLALKVLRTAEFAPFVVFIAAPTITP--------GLNEDESLQR----L 921

  Fly   184 QVELD---------YGLTPGNFHKIINNVDID 206
            |.|.|         :.||      |||| :||
Mouse   922 QKESDVLQRTYAHYFDLT------IINN-EID 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 58/222 (26%)
guanyl_kin 36..216 CDD:213788 58/220 (26%)
CaskXP_011245733.1 STKc_CASK 8..313 CDD:270996
L27 354..407 CDD:197794
L27 412..462 CDD:397114
PDZ_signaling 494..574 CDD:238492
SH3_CASK 622..683 CDD:213014
Guanylate_kin 744..957 CDD:395500 58/222 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.