DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and dlg1a

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_005165955.1 Gene:dlg1a / 114446 ZFINID:ZDB-GENE-010724-8 Length:935 Species:Danio rerio


Alignment Length:232 Identity:68/232 - (29%)
Similarity:123/232 - (53%) Gaps:34/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VNRALSSSSSSSSAA-----------ASLTSKKMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPS 61
            |::.::|::|.|.::           .::|.::::.  .||:::.||.   |..:...|.:|||.
Zfish   709 VDQHVTSNASDSESSFRGQEDYVLSYETVTQQEVSY--SRPVIILGPM---KDRINDDLISEFPD 768

  Fly    62 TFGFSISHTTRKPREGEEHGVHYYFV-ERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQ 125
            .||..:.||||..|:.|..|..|:|| .|.:||..|...:|||..::..:|||||..:|||:..:
Zfish   769 KFGSCVPHTTRPKRDYEVDGRDYHFVNSREQMEKDIQDHKFIEAGQYNNHLYGTSVQSVREVAEK 833

  Fly   126 GRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIK---ELERRL-RKRGSETEESLSKRLNAAQVE 186
            |:.||||:....:::::...|.||.:|..|.|::   |:.:|| .::|.:|.:      .|.::|
Zfish   834 GKHCILDVSGNAIKRLQLAQLYPIAVFIKPKSVENILEMNKRLMEEQGRKTYD------RAMKLE 892

  Fly   187 LDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQELKEQ 223
            .::   ..:|..|:....:    ||..|.|.|.::||
Zfish   893 QEF---LEHFTAIVQGDTL----EEIYNQVKQIIEEQ 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 60/189 (32%)
guanyl_kin 36..216 CDD:213788 59/184 (32%)
dlg1aXP_005165955.1 L27_1 4..62 CDD:286187
MAGUK_N_PEST 109..230 CDD:287565
PDZ_signaling 231..315 CDD:238492
PDZ_signaling 324..410 CDD:238492
PDZ_assoc 411..474 CDD:287558
PDZ 472..556 CDD:214570
SH3 588..661 CDD:302595
Guanylate_kin 744..922 CDD:279019 61/195 (31%)
GuKc 755..922 CDD:214504 57/179 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.