DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG11811 and PATJ

DIOPT Version :9

Sequence 1:	NP_648408.1	Gene:	CG11811 / 39213	FlyBaseID:	FBgn0036099	Length:	233	Species:	Drosophila melanogaster
Sequence 2:	XP_011538764.1	Gene:	PATJ / 10207	HGNCID:	28881	Length:	1937	Species:	Homo sapiens

Alignment Length:	111	Identity:	26/111 - (23%)
Similarity:	45/111 - (40%)	Gaps:	22/111 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   131 LDIEQKG-----------VEQIKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAAQ 184
            :.:::||           .|.:|....|.||....  |||:|:.:|....|:...:.........
Human    21 MKLQEKGDTSQNEKLSMFYETLKSPLFNQILTLQQ--SIKQLKGQLNHIPSDCSANFDFSRKGLL 83

  Fly   185 VELDYGLTPGNFHKIINNVDID--------VAYEEFRNFVVQELKE 222
            |..|..:|.||.|:..||..:.        :..|:| |.|:|::.:
Human    84 VFTDGSITNGNVHRPSNNSTVSGLFPWTPKLGNEDF-NSVIQQMAQ 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG11811	NP_648408.1	Guanylate_kin	34..219	CDD:279019	25/106 (24%)
CG11811	NP_648408.1	guanyl_kin	36..216	CDD:213788	24/103 (23%)
PATJ	XP_011538764.1	L27_2	8..65	CDD:117611	11/45 (24%)
		PDZ_signaling	135..218	CDD:238492
		PDZ_signaling	246..325	CDD:238492
		PDZ_signaling	366..450	CDD:238492
		PDZ_signaling	570..634	CDD:238492
		PDZ	683..772	CDD:214570
		PDZ_signaling	1066..1157	CDD:238492
		PDZ	1236..1321	CDD:214570
		PDZ	1459..1574	CDD:214570
		PDZ_signaling	1586..1666	CDD:238492
		PDZ_signaling	1729..1814	CDD:238492
		PDZ_signaling	1852..1936	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0194
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900