DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and dlg5b.1

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_021336124.1 Gene:dlg5b.1 / 101883945 ZFINID:ZDB-GENE-120206-4 Length:1907 Species:Danio rerio


Alignment Length:165 Identity:38/165 - (23%)
Similarity:72/165 - (43%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEME 93
            |:.:...||:::.||.......:|.|   |.|..:...:....:..::..|.||....       
Zfish  1721 KVESTNRRPVLILGPLVEPIKDMLLR---EAPGKYCRCLPEGMKAQQQAIERGVKDCL------- 1775

  Fly    94 AAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIF---NNP 155
                   ||:....:|:...|:.|:::||..:...|:|||....:|::....:.||:||   .|.
Zfish  1776 -------FIDYKRRSGHFDVTTVASIKEITEKDCHCLLDIAPHAIERLHAVSIYPIVIFIRYRNA 1833

  Fly   156 PSIKELERRLRKRGSETEESLSKRLNAAQ-VELDY 189
            ..|||.:..:..|...:::...::..:|| :|.||
Zfish  1834 KQIKEQKDPVYLRDKVSQKHSKEQFESAQRIEQDY 1868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 37/160 (23%)
guanyl_kin 36..216 CDD:213788 37/158 (23%)
dlg5b.1XP_021336124.1 Takusan 120..209 CDD:309799
APG6 232..>311 CDD:309295
SMC_N <287..661 CDD:330553
PDZ_signaling 686..774 CDD:238492
PDZ_signaling <797..857 CDD:238492
PDZ 1345..1426 CDD:214570
dbPDZ_assoc 1425..1486 CDD:318751
PDZ 1491..1567 CDD:214570
SH3_DLG5 1585..1647 CDD:212794
NK 1740..1896 CDD:327404 33/146 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.