DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and LOC100537443

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_003199722.2 Gene:LOC100537443 / 100537443 -ID:- Length:201 Species:Danio rerio


Alignment Length:165 Identity:38/165 - (23%)
Similarity:72/165 - (43%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KMTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEME 93
            |:.:...||:::.||.......:|.|   |.|..:...:....:..::..|.||....       
Zfish    15 KVESTNRRPVLILGPLVEPIKDMLLR---EAPGKYCRCLPEGMKAQQQAIERGVKDCL------- 69

  Fly    94 AAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIF---NNP 155
                   ||:....:|:...|:.|:::||..:...|:|||....:|::....:.||:||   .|.
Zfish    70 -------FIDYKRRSGHFDVTTVASIKEITEKDCHCLLDIAPHAIERLHAVSIYPIVIFIRYRNA 127

  Fly   156 PSIKELERRLRKRGSETEESLSKRLNAAQ-VELDY 189
            ..|||.:..:..|...:::...::..:|| :|.||
Zfish   128 KQIKEQKDPVYLRDKVSQKHSKEQFESAQRIEQDY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 37/160 (23%)
guanyl_kin 36..216 CDD:213788 37/158 (23%)
LOC100537443XP_003199722.2 NK 34..190 CDD:327404 33/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.