DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11811 and dlg4

DIOPT Version :9

Sequence 1:NP_648408.1 Gene:CG11811 / 39213 FlyBaseID:FBgn0036099 Length:233 Species:Drosophila melanogaster
Sequence 2:XP_009300293.1 Gene:dlg4 / 100000823 -ID:- Length:805 Species:Danio rerio


Alignment Length:180 Identity:64/180 - (35%)
Similarity:96/180 - (53%) Gaps:25/180 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFV-ERPEMEAAIAGD 99
            ||:::.||.   |..:...|.:|||..||..:.||||..||.|..|..|:|| .|.:||..|...
Zfish   615 RPIIILGPV---KDRVNDDLLSEFPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMEKDIQNH 676

  Fly   100 EFIETAEFTGNLYGTSKAAVREI-QAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIK---E 160
            .|||..::..:|||||..:|||: :.||:.||||:....|.:::...|:||.||..|.|::   |
Zfish   677 RFIEAGQYNSHLYGTSVQSVREVAEQQGKHCILDVSANAVRRLQAAQLHPIAIFVRPKSLENVLE 741

  Fly   161 LERRLRKRGSETEESLSKRLN-AAQVELDY-----GLTPGN-----FHKI 199
            :..||      |||...|.:: |.::|.|:     .:..|:     :||:
Zfish   742 INTRL------TEEQARKGMDRAIKLEQDFLECFSAIVEGDSFEEVYHKV 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11811NP_648408.1 Guanylate_kin 34..219 CDD:279019 64/180 (36%)
guanyl_kin 36..216 CDD:213788 64/180 (36%)
dlg4XP_009300293.1 MAGUK_N_PEST 39..141 CDD:287565
PDZ_signaling 142..226 CDD:238492
PDZ 234..323 CDD:214570
PDZ_assoc 334..389 CDD:287558
DegQ <372..465 CDD:223343
PDZ 388..471 CDD:214570
SH3 507..572 CDD:302595
Guanylate_kin 613..792 CDD:279019 64/180 (36%)
GuKc 624..792 CDD:214504 60/168 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0194
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.