DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment simj and Nynrin

DIOPT Version :9

Sequence 1:NP_001261685.1 Gene:simj / 39212 FlyBaseID:FBgn0010762 Length:937 Species:Drosophila melanogaster
Sequence 2:NP_001035161.1 Gene:Nynrin / 277154 MGIID:2652872 Length:1840 Species:Mus musculus


Alignment Length:509 Identity:106/509 - (20%)
Similarity:172/509 - (33%) Gaps:143/509 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ITPSASPAT------NNGTTSNSSNTNSNSSSTTTTTNNNNNSSSNTNSSSANNNNNNNSINASD 108
            :|...||.|      .|..:.||..|.|:.::.:.|...:..:....:..:.:.:|.......|.
Mouse   235 VTIKESPGTLQEIGALNRASENSKKTTSSGAAGSLTQAQSPPAQETADQLARDQSNKQGDETNSV 299

  Fly   109 GVTGATSGSIGGGQDENKVQRRVLRPRTEPKSYAEAPDIVLLP-----ARTN----------GRQ 158
            |..|..:........||..| .:|:.:..||:  |....:|||     |.|:          |..
Mouse   300 GEEGTATQDTSSQDSENPTQ-ALLQQKQVPKN--EERISLLLPVSALSAYTSWKVWAPGTAFGPS 361

  Fly   159 QNGNIDSETDDEEMPPYVPIKELSHAELK-------------EREKSLRKLRQDLRNEETKLMLL 210
            ..|.|.:        .:..|.||....|.             :|.....:|:...||.     |.
Mouse   362 WPGTIAA--------TFWKINELQSLHLAWLLSQACLNFPFWQRPTGPIQLKLPGRNP-----LP 413

  Fly   211 KKLKQSQQVMKENLVVTPTSVSP---------------NNPLSAIPAALTSKGSLSVTPTSA--- 257
            .||:..|    :.||...::.||               ::|...||:.:.   ||||.|...   
Mouse   414 LKLEWKQ----KELVPLSSAGSPACRPGGDLGRETALKHSPRPEIPSKII---SLSVVPGGCGIK 471

  Fly   258 ---------VPLPAHSKGSRS-SLSGSGG--PAVSISATNSRTGSSSSAAAAAS----------- 299
                     |...:.|.|.:. |||...|  ...|::.:..:.||::.....|.           
Mouse   472 EKVSPGLLQVGQSSTSVGDKGISLSDCKGLEKPFSLALSTEQGGSTAQERPLAQVPEAPTVSETL 536

  Fly   300 --AIAAAAMSGQHRSGSNSILPPPRSSLPAGATLAAGTTI-TPATSSSHRSSNLPPRTNLPNLTI 361
              |.||...:.:|        ||....||  ||....|.: .||..:...:..:|.....|....
Mouse   537 QVATAAEVSNVEH--------PPTGEGLP--ATPKVPTALKKPAVYTEPTAPKVPSAPTEPAAPA 591

  Fly   362 TPSVTITPTSAPPSSLK-------PRNVPGTISNSVSITPALPLSQSHQNQHNDQKNDRSTPRED 419
            ||:...|||:....|:|       |:....||:.:.|..|..|.:.:           .:.|..|
Mouse   592 TPTAPQTPTAQKTPSVKTLAGLQTPKVQSETIATAGSEVPKAPAASA-----------VAGPTVD 645

  Fly   420 -AQTPAQRQAAAKMALRKQLEKTLLQIPPPKPPPPEMHFIPN---PSNTDFVYL 469
             ||..::.||:...|:       :|::   :..|....|.|:   ||.:...:|
Mouse   646 VAQLLSEVQASKNRAI-------MLKV---QGKPGRQGFQPSSTVPSRSKHQFL 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
simjNP_001261685.1 P66_CC 185..222 CDD:293171 9/49 (18%)
NynrinNP_001035161.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..327 14/78 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 427..449 2/21 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..564 7/28 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..615 9/40 (23%)
RNase_Zc3h12a 739..890 CDD:288804
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..968
RNase_H_like 1104..1207 CDD:301345
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1125..1149
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3740
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.