DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8003 and ANKRD45

DIOPT Version :9

Sequence 1:	NP_001261683.1	Gene:	CG8003 / 39210	FlyBaseID:	FBgn0036096	Length:	407	Species:	Drosophila melanogaster
Sequence 2:	XP_016856612.1	Gene:	ANKRD45 / 339416	HGNCID:	24786	Length:	286	Species:	Homo sapiens

Alignment Length:	144	Identity:	34/144 - (23%)
Similarity:	54/144 - (37%)	Gaps:	21/144 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 LLDHLAKNDTSGFKQLLSGVRNVNF---------VDDTGMSCLAHASFKGNREAVQLLLDMGADI 73
            ||......|..|.:::.....|.:.         .|..|.:.|..|...|..:.::.|...|  :
Human    59 LLQPALTGDVEGLQKIFEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYG--V 121

  Fly    74 NLNQHGA-DYTPLHFAALSGNTHVCRLLLDAGIKPGSINSVNRTAAQMAAFVGNHACVE------ 131
            |||:... .||.||.||..|.....:.|::..:...::|.....|..:||......|||
Human   122 NLNEKTTRGYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWAD 186

  Fly   132 ---TINNYVTQSSL 142
               |:..|:.:.||
Human   187 ARLTLKKYIAKVSL 200

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8003	NP_001261683.1	ANK	21..133	CDD:238125	28/130 (22%)
		Ank_2	21..107	CDD:289560	21/95 (22%)
		ANK repeat	46..76	CDD:293786	7/29 (24%)
		ANK repeat	78..105	CDD:293786	8/27 (30%)
		zf-MYND	333..370	CDD:280009
ANKRD45	XP_016856612.1	ANK repeat	58..94	CDD:293786	5/34 (15%)
		ANK	94..>182	CDD:238125	25/89 (28%)
		Ank_4	97..150	CDD:290365	16/54 (30%)
		ANK repeat	97..127	CDD:293786	9/31 (29%)
		ANK repeat	129..160	CDD:293786	8/30 (27%)
		Ank_4	130..182	CDD:290365	15/51 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000