| Sequence 1: | NP_001261683.1 | Gene: | CG8003 / 39210 | FlyBaseID: | FBgn0036096 | Length: | 407 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_055240.2 | Gene: | INVS / 27130 | HGNCID: | 17870 | Length: | 1065 | Species: | Homo sapiens |
| Alignment Length: | 280 | Identity: | 66/280 - (23%) |
|---|---|---|---|
| Similarity: | 113/280 - (40%) | Gaps: | 48/280 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 DDVQRQLLD------------------HLA--KNDTSGFKQLLSGVRNVNFVDDTGMSCLAHASF 56
Fly 57 KGNREAVQLLLDMGADINL-NQHGADYTPLHFAALSGNTHVCRLLLDAGIKPGSINSVNRTAAQM 120
Fly 121 AAFVGNHACVETINNYVTQSSL---EYYTQVHGQQTEPHIPP-SLLKSFHAFVTEINLH-----P 176
Fly 177 VRIALNVQSLGLLRILSSLRKTLALMCEKEMQKSHDLNELLAFKFH--YQGWILAELIRCEEQFK 239
Fly 240 AQH----KEKSGEEAGDANK 255 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8003 | NP_001261683.1 | ANK | 21..133 | CDD:238125 | 37/114 (32%) |
| Ank_2 | 21..107 | CDD:289560 | 29/88 (33%) | ||
| ANK repeat | 46..76 | CDD:293786 | 8/30 (27%) | ||
| ANK repeat | 78..105 | CDD:293786 | 11/26 (42%) | ||
| zf-MYND | 333..370 | CDD:280009 | |||
| INVS | NP_055240.2 | ANK 1 | 13..42 | ||
| Ank_2 | 19..111 | CDD:289560 | |||
| ANK | 42..169 | CDD:238125 | |||
| ANK repeat | 47..78 | CDD:293786 | |||
| ANK 2 | 47..76 | ||||
| ANK repeat | 80..146 | CDD:293786 | |||
| ANK 3 | 80..110 | ||||
| Ank_2 | 85..179 | CDD:289560 | |||
| ANK 4 | 113..144 | ||||
| ANK | 143..309 | CDD:238125 | |||
| ANK repeat | 148..179 | CDD:293786 | |||
| ANK 5 | 148..177 | ||||
| ANK repeat | 181..218 | CDD:293786 | |||
| ANK 6 | 181..213 | ||||
| Ank_4 | 185..240 | CDD:290365 | |||
| ANK repeat | 220..252 | CDD:293786 | |||
| ANK 7 | 220..250 | ||||
| Ank_2 | 225..319 | CDD:289560 | |||
| ANK 8 | 254..283 | ||||
| ANK repeat | 256..286 | CDD:293786 | |||
| ANK 9 | 288..317 | ||||
| ANK repeat | 288..313 | CDD:293786 | |||
| Ank_2 | 293..387 | CDD:289560 | 12/51 (24%) | ||
| ANK | 316..443 | CDD:238125 | 32/109 (29%) | ||
| ANK repeat | 321..354 | CDD:293786 | 5/18 (28%) | ||
| ANK 10 | 321..350 | 5/14 (36%) | |||
| ANK repeat | 356..387 | CDD:293786 | 7/30 (23%) | ||
| ANK 11 | 356..385 | 7/28 (25%) | |||
| Ank_2 | 361..453 | CDD:289560 | 30/93 (32%) | ||
| ANK | 384..509 | CDD:238125 | 34/126 (27%) | ||
| ANK repeat | 389..420 | CDD:293786 | 8/30 (27%) | ||
| ANK 12 | 389..418 | 7/28 (25%) | |||
| ANK repeat | 422..453 | CDD:293786 | 13/32 (41%) | ||
| ANK 13 | 422..451 | 13/30 (43%) | |||
| Ank_2 | 427..517 | CDD:289560 | 27/89 (30%) | ||
| ANK repeat | 455..486 | CDD:293786 | 7/30 (23%) | ||
| ANK 14 | 455..484 | 7/28 (25%) | |||
| ANK 15 | 488..517 | 8/28 (29%) | |||
| ANK repeat | 488..516 | CDD:293786 | 8/27 (30%) | ||
| D-box 1 | 490..498 | 2/7 (29%) | |||
| ANK repeat | 521..548 | CDD:293786 | 6/36 (17%) | ||
| ANK 16 | 523..553 | 6/39 (15%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 589..833 | 3/14 (21%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 847..886 | ||||
| D-box 2 | 909..917 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 976..999 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4213 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.860 | |||||