DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(z) and SETD7

DIOPT Version :9

Sequence 1:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_085151.1 Gene:SETD7 / 80854 HGNCID:30412 Length:366 Species:Homo sapiens


Alignment Length:120 Identity:36/120 - (30%)
Similarity:49/120 - (40%) Gaps:21/120 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   641 AGWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKI-- 703
            ||.|:|.|.....|..:|.|.|..|:..|.|.|    |..:.....:|:.:.|:|.....|.:  
Human   226 AGEGLFSKVAVGPNTVMSFYNGVRITHQEVDSR----DWALNGNTLSLDEETVIDVPEPYNHVSK 286

  Fly   704 ------RFANHSINPNCYAKVMMVTGDH-RIG----IFAKRAIQPGEELFFDYRY 747
                  ..||||..|||...:.:    | |.|    |...||::..|||...|.|
Human   287 YCASLGHKANHSFTPNCIYDMFV----HPRFGPIKCIRTLRAVEADEELTVAYGY 337

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
E(z)NP_001261682.1 SANT 452..492 CDD:238096
SET <471..745 CDD:225491 34/116 (29%)
SET 631..747 CDD:214614 35/118 (30%)
SETD7NP_085151.1 MORN 1 36..58
YwqK <37..134 CDD:225405
MORN 2 59..81
MORN 3 106..128
SET_SETD7 208..337 CDD:380928 35/118 (30%)
S-adenosyl-L-methionine binding 226..228 1/1 (100%)
Substrate binding 256..258 1/1 (100%)
Substrate binding 266..268 0/1 (0%)