DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(z) and Setd7

DIOPT Version :9

Sequence 1:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001103028.1 Gene:Setd7 / 689954 RGDID:1586346 Length:366 Species:Rattus norvegicus


Alignment Length:175 Identity:47/175 - (26%)
Similarity:67/175 - (38%) Gaps:32/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 LAVRECDPDLCQACGADQFKLTKITCKNVCVQRGL-------HKHLLMAPSDI--AGWGIFLKEG 650
            :|..|..|......|:..|...|.|  :.|:....       .:.:.:|.|.|  ||.|:|.|..
  Rat   173 MATEEGKPHFELTSGSSVFHFDKST--SSCISSDALLPDPYESERVYVADSLISSAGEGLFSKVA 235

  Fly   651 AQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKI--------RFAN 707
            ...|..:|.|.|..|:..|.|.|    |..:.....:|:.:.|:|.....|.:        ..||
  Rat   236 VGPNTVMSFYNGVRITHQEVDSR----DWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKAN 296

  Fly   708 HSINPNCYAKVMMVTGDH-RIG----IFAKRAIQPGEELFFDYRY 747
            ||..|||...:.:    | |.|    |...||::..|||...|.|
  Rat   297 HSFTPNCVYDMFV----HPRFGPIKCIRTLRAVEAEEELTVAYGY 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(z)NP_001261682.1 SANT 452..492 CDD:238096
SET <471..745 CDD:225491 45/171 (26%)
SET 631..747 CDD:214614 38/130 (29%)
Setd7NP_001103028.1 SET 226..342 CDD:214614 36/120 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1079
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.