DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(z) and Su(var)3-9

DIOPT Version :9

Sequence 1:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_524357.2 Gene:Su(var)3-9 / 41483 FlyBaseID:FBgn0263755 Length:635 Species:Drosophila melanogaster


Alignment Length:311 Identity:79/311 - (25%)
Similarity:130/311 - (41%) Gaps:71/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 RKKKKKQRLWSLHCRKIQLKK---------------DSSSNHVYNYTPCDHPGHPCDMN------ 553
            |.:::.|::.....:.:|:|:               :...|||...:|.....:..|::      
  Fly   326 RSQREPQKIGERALKSMQIKRAQFVRRKQLADLALFEKRMNHVEKPSPPIRVENNIDLDTIDSNF 390

  Fly   554 ---------------------CSCIQTQNFCEKFCNCSSDCQNRFPGCRCKAQCNTKQCPCY--L 595
                                 |.|  |::..|  |..|:.|..||.|.....:.:|::....  .
  Fly   391 MYIHDNIIGKDVPKPEAGIVGCKC--TEDTEE--CTASTKCCARFAGELFAYERSTRRLRLRPGS 451

  Fly   596 AVRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHL-LMAPSDIAGWGIFLKEGAQKNEFISE 659
            |:.||:    ..|..|.      :|.|..||.|....| |...::.:|||:......:|.||:.|
  Fly   452 AIYECN----SRCSCDS------SCSNRLVQHGRQVPLVLFKTANGSGWGVRAATALRKGEFVCE 506

  Fly   660 YCGEIISQDEADRRGKVYDKYMCSFLFNL------NNDFVVDATRKGNKIRFANHSINPN----- 713
            |.||||:.|||:.|||.||....::||:|      ::::.:||...||...|.|||.:||     
  Fly   507 YIGEIITSDEANERGKAYDDNGRTYLFDLDYNTAQDSEYTIDAANYGNISHFINHSCDPNLAVFP 571

  Fly   714 CYAKVMMVTGDHRIGIFAKRAIQPGEELFFDYRYGPTEQLKFVGIEREMEI 764
            |:.:.:.|...|.: .|..|.|:.||||.|||.....|.:.:..:...:.:
  Fly   572 CWIEHLNVALPHLV-FFTLRPIKAGEELSFDYIRADNEDVPYENLSTAVRV 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(z)NP_001261682.1 SANT 452..492 CDD:238096
SET <471..745 CDD:225491 76/290 (26%)
SET 631..747 CDD:214614 48/127 (38%)
Su(var)3-9NP_524357.2 P-loop_NTPase 41..>80 CDD:304359
CHROMO 217..268 CDD:237991
PreSET 362..455 CDD:128744 17/96 (18%)
SET 477..609 CDD:214614 48/132 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.