DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(z) and CG4565

DIOPT Version :9

Sequence 1:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001097743.1 Gene:CG4565 / 41303 FlyBaseID:FBgn0037841 Length:269 Species:Drosophila melanogaster


Alignment Length:210 Identity:66/210 - (31%)
Similarity:96/210 - (45%) Gaps:44/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 CRCKAQC-NTKQCP-----------CYLAVR-------ECDPDLCQACGADQFKLTKITCKNVCV 625
            |.||..| |::.|.           ..|.:|       ||: |:|:.|        :.||.|..|
  Fly    50 CHCKGACENSEVCAHGGQYEFTEDGSELILRNSANPVIECN-DMCKCC--------RNTCSNRLV 105

  Fly   626 QRGLHKHLLMAPSDIAG-WGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDKY---MCSFLF 686
            ..|..|||.:..|.:.| .|:.......|..:|.||.||:::..||  |.:::|..   :.:::.
  Fly   106 YSGPRKHLEIFDSPVYGSKGLRTTAKITKGGYICEYAGELLTVPEA--RSRLHDNEKLGLMNYIL 168

  Fly   687 NLN---ND-----FVVDATRKGNKIRFANHSINPNCY-AKVMMVTGDHRIGIFAKRAIQPGEELF 742
            .||   :|     .:||.:|:||..|:.|||..|||: |.|.:.....:|||||.|.|...|||.
  Fly   169 VLNEYTSDKKQQVTIVDPSRRGNIGRYLNHSCEPNCHIAAVRIDCPIPKIGIFAARDIAAKEELC 233

  Fly   743 FDYRYGPTEQLKFVG 757
            |.|. |..:..|..|
  Fly   234 FHYG-GEGQYKKMTG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(z)NP_001261682.1 SANT 452..492 CDD:238096
SET <471..745 CDD:225491 62/196 (32%)
SET 631..747 CDD:214614 45/128 (35%)
CG4565NP_001097743.1 Pre-SET 10..103 CDD:282838 15/61 (25%)
SET 111..239 CDD:214614 45/130 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.