DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment E(z) and G9a

DIOPT Version :9

Sequence 1:NP_001261682.1 Gene:E(z) / 39203 FlyBaseID:FBgn0000629 Length:765 Species:Drosophila melanogaster
Sequence 2:NP_001259088.1 Gene:G9a / 30971 FlyBaseID:FBgn0040372 Length:1657 Species:Drosophila melanogaster


Alignment Length:234 Identity:71/234 - (30%)
Similarity:96/234 - (41%) Gaps:53/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   556 CIQTQNFCE--------KFCNCSSDCQNRFPGCRCKAQCN-TKQCPCYLA--------------- 596
            ||..||..:        :.|:|...|.:.    ||  ||| ......|.|               
  Fly  1399 CIIQQNSVQIDRRVSQMRICSCLDSCSSD----RC--QCNGASSQNWYTAESRLNADFNYEDPAV 1457

  Fly   597 VRECDPDLCQACGADQFKLTKITCKNVCVQRGLHKHLLMAPSD--IAGWGIFLKEGAQKNEFISE 659
            :.||:    ..||.:|     ::|||..||.|....|.:...:  ..|||:.......|..|:..
  Fly  1458 IFECN----DVCGCNQ-----LSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGS 1513

  Fly   660 YCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSINPNCY-AKVMMVTG 723
            |.|||::..|||||..      .|:.|:|:|...:||...||..||.|||..||.. .:|.....
  Fly  1514 YTGEILTAMEADRRTD------DSYYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQ 1572

  Fly   724 DHR---IGIFAKRAIQPGEELFFDY--RYGPTEQLKFVG 757
            |:|   |..|:.|.|..|||:.|||  ::...|....||
  Fly  1573 DYRFPKIAFFSCRDIDAGEEICFDYGEKFWRVEHRSCVG 1611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
E(z)NP_001261682.1 SANT 452..492 CDD:238096
SET <471..745 CDD:225491 66/218 (30%)
SET 631..747 CDD:214614 43/123 (35%)
G9aNP_001259088.1 ATP-synt_B 150..248 CDD:304375
Ank_2 1056..1152 CDD:289560
ANK 1088..1217 CDD:238125
ANK repeat 1088..1120 CDD:293786
ANK repeat 1124..1153 CDD:293786
Ank_2 1127..1249 CDD:289560
ANK 1155..1306 CDD:238125
ANK repeat 1155..1196 CDD:293786
ANK repeat 1199..1249 CDD:293786
Ank_2 1205..1316 CDD:289560
ANK repeat 1251..1283 CDD:293786
ANK repeat 1285..1316 CDD:293786
PreSET 1357..1466 CDD:128744 16/76 (21%)
SET 1495..1602 CDD:214614 42/112 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.