DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14151 and CG43127

DIOPT Version :10

Sequence 1:NP_648399.2 Gene:CG14151 / 39201 FlyBaseID:FBgn0036089 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001097575.2 Gene:CG43127 / 8673982 FlyBaseID:FBgn0262592 Length:190 Species:Drosophila melanogaster


Alignment Length:113 Identity:28/113 - (24%)
Similarity:62/113 - (54%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 WTALVALIFTIFWMVIIIVLMAGIYRRKLGLVRFWLVFTCLGILLDGFILL---YGLTLAISVNW 102
            |.....|:....|:.:.::::|||..:|..|:..||::...|::.|.|::|   |.|.:..::  
  Fly    71 WIFWGYLLMLNIWIGVTLLMIAGISFQKPELMTLWLIWCACGLVFDVFLILWWVYELFVGDAI-- 133

  Fly   103 EGVKITVLPFVGLAVEMTFVYIIYLLYLDMIDYSATETPPDEKYRERS 150
            |.:...::..:.:|:|..|:|:||.::|::.:.:..|   :.|..|:|
  Fly   134 EALTNILISLLTMAIEFGFIYVIYTIFLNLSNATKNE---ETKVAEKS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14151NP_648399.2 DUF4728 46..129 CDD:374176 22/85 (26%)
CG43127NP_001097575.2 None

Return to query results.
Submit another query.