DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14151 and CG42536

DIOPT Version :10

Sequence 1:NP_648399.2 Gene:CG14151 / 39201 FlyBaseID:FBgn0036089 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001163411.1 Gene:CG42536 / 8673967 FlyBaseID:FBgn0260644 Length:184 Species:Drosophila melanogaster


Alignment Length:153 Identity:35/153 - (22%)
Similarity:72/153 - (47%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SDGYLVPCAYCIALLDFISALLFAIISGVVFARHGHWTALVALIFTIFWMVIIIVLMAGIYRRKL 69
            :|..|..| :.|...:.:.:|.|:..|..:...|.:|..::|.:.||.|:..:..|..|:...:.
  Fly    12 TDNLLRTC-FVIGAFELVRSLYFSFSSVSLMVLHTNWYTIMAFLSTIAWIATVGGLFVGLLTSRP 75

  Fly    70 GLVRFWLVFTCLGILLDGFILLYGLTLAISVNWEGVKITVLPFVGLAVEMTFVYIIYLLYLDMID 134
            .|:.|||:||......|...|::.:|.:...:.|.:|...:.::|:..|:|.:|:::..:..:..
  Fly    76 TLLVFWLLFTAFATATDIIYLIWNVTSSPIFDAEHLKRWTISYLGIFYEVTCLYLVFRYFRRLYS 140

  Fly   135 Y---------SATETPPDEKYRE 148
            |         :.|:....|.||:
  Fly   141 YVLLEGDNYDTTTKDRKTEDYRD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14151NP_648399.2 DUF4728 46..129 CDD:374176 21/82 (26%)
CG42536NP_001163411.1 DUF4728 52..138 CDD:374176 21/85 (25%)

Return to query results.
Submit another query.