DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbfox1 and AT3G46020

DIOPT Version :9

Sequence 1:NP_001246707.1 Gene:Rbfox1 / 39198 FlyBaseID:FBgn0052062 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_190188.1 Gene:AT3G46020 / 823745 AraportID:AT3G46020 Length:102 Species:Arabidopsis thaliana


Alignment Length:82 Identity:31/82 - (37%)
Similarity:45/82 - (54%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 AKSQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNE--RGSKGFGFVTFANSNDAERARE 517
            ||....:|.||.:.....|..||.:|..||.|.:..:|.:.  :..|||||:||.:.:||.:|.:
plant     2 AKRISAQLFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDSEDDARKALK 66

  Fly   518 RLHGTVVEGRKIEVNNA 534
            .|.|.:|:||.|.|..|
plant    67 SLDGKIVDGRLIFVEVA 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbfox1NP_001246707.1 RRM <454..>542 CDD:223796 31/82 (38%)
RRM_FOX1_like 460..535 CDD:240853 29/77 (38%)
AT3G46020NP_190188.1 RRM 9..80 CDD:214636 27/70 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.