DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rbfox1 and spn-4

DIOPT Version :9

Sequence 1:NP_001246707.1 Gene:Rbfox1 / 39198 FlyBaseID:FBgn0052062 Length:962 Species:Drosophila melanogaster
Sequence 2:NP_504717.1 Gene:spn-4 / 179070 WormBaseID:WBGene00004984 Length:351 Species:Caenorhabditis elegans


Alignment Length:151 Identity:61/151 - (40%)
Similarity:79/151 - (52%) Gaps:11/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 NAAAAAASGIVSPSANVATSLSSALVPAQSVAAVAAASLDAKSQPKRLHVSNIPFRFRDPDLRAM 479
            |.|..|..|:...|||.:.......:|   ::........|.....|::||||||.||:.||.||
 Worm     9 NFAHRAHDGLPFNSANPSNKDPIFTMP---ISVKPKTREPASFTDNRIYVSNIPFSFREQDLAAM 70

  Fly   480 FGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKVT 544
            |..:|.:|.|||:.|:||||||||||..:....|:||..||.:.|:||.|||..||. .:.|.:.
 Worm    71 FFAYGRVLSVEIVTNDRGSKGFGFVTLDSIESCEKARAALHESHVQGRIIEVRRATP-TRRKLIN 134

  Fly   545 AVPNVVLTKDGAIPAPALVCV 565
            ...|.||      |.|.| ||
 Worm   135 NPQNEVL------PPPKL-CV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rbfox1NP_001246707.1 RRM <454..>542 CDD:223796 44/87 (51%)
RRM_FOX1_like 460..535 CDD:240853 41/74 (55%)
spn-4NP_504717.1 RRM_SF 51..126 CDD:388407 41/74 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0125
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15597
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.