DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6527 and AT5G63060

DIOPT Version :10

Sequence 1:NP_788493.1 Gene:CG6527 / 39197 FlyBaseID:FBgn0036085 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_201111.2 Gene:AT5G63060 / 836426 AraportID:AT5G63060 Length:263 Species:Arabidopsis thaliana


Alignment Length:136 Identity:28/136 - (20%)
Similarity:51/136 - (37%) Gaps:38/136 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KHEITIKNVGE---KTVTYKVQCTVHGKFNIKPRWGVL-SPNEHSHVLITMCKDVELSRKGRDKI 84
            :||..:..:.|   |..|...:..|||..::|.|..|: :|.:|...|:...:|        :|:
plant   100 RHEFKVDELSEDSIKAATDTGKAYVHGFLDVKGRPVVIVAPAKHIPGLLDPIED--------EKL 156

  Fly    85 VVVCMVSPINAVDFEMTASFWRHNICYDPSIEKHQLTCHQMDGAGEGHGDGGDKDAEPEDLRFRQ 149
            .|..:                      :.::.|.....|::.|..:..|.|    ::..||:|..
plant   157 CVFLL----------------------EKALSKLPAGQHKILGIFDLRGFG----SQNADLKFLT 195

  Fly   150 GLFPSF 155
            .||..|
plant   196 FLFDVF 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6527NP_788493.1 Motile_Sperm 8..110 CDD:459882 17/89 (19%)
AT5G63060NP_201111.2 SEC14 120..261 CDD:469559 23/116 (20%)

Return to query results.
Submit another query.