DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6527 and ZC196.2

DIOPT Version :10

Sequence 1:NP_788493.1 Gene:CG6527 / 39197 FlyBaseID:FBgn0036085 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_505251.2 Gene:ZC196.2 / 191101 WormBaseID:WBGene00022546 Length:345 Species:Caenorhabditis elegans


Alignment Length:122 Identity:30/122 - (24%)
Similarity:52/122 - (42%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LEISPNSTLTFTKTNNKHE---ITIKNVGEKTVTYKVQCTVHGKFNIKPRWGVLSPNEHSHVLIT 69
            ||::|.....|.|:.|..:   :|:||:.||.|.:||:.:|...:..:|...:|.|.|...:.:.
 Worm     8 LEVTPCDNFVFNKSTNLTDTAYVTLKNISEKPVCFKVKTSVPNMYVSRPNPDLLKPGEARQLSVK 72

  Fly    70 M--CKDVELSRKGRDKIVVVCMVSPINAVDFEMTASFWRHNICYDPSIEKHQLTCHQ 124
            .  ...|.|:.|.....:..|   ...:.|.:...|||       .||...::..|:
 Worm    73 FRSSDKVSLNAKSYKLKIESC---EFESEDIDDLKSFW-------SSIPNEKILVHK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6527NP_788493.1 Motile_Sperm 8..110 CDD:459882 27/106 (25%)
ZC196.2NP_505251.2 Motile_Sperm 7..112 CDD:459882 29/113 (26%)
YhaN 207..>344 CDD:443752
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.