DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32061 and LAP2

DIOPT Version :10

Sequence 1:NP_729611.1 Gene:CG32061 / 39196 FlyBaseID:FBgn0052061 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_194821.1 Gene:LAP2 / 829216 AraportID:AT4G30920 Length:583 Species:Arabidopsis thaliana


Alignment Length:38 Identity:13/38 - (34%)
Similarity:18/38 - (47%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SGKS-EVSMEKKGILKTTTTAAEQVKNNWIKKQNSALK 116
            |||. :|:..|..||....|..:..|:...|.:|..||
plant    82 SGKEIDVTEWKGDILAVGVTEKDMAKDVNSKFENPILK 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32061NP_729611.1 None
LAP2NP_194821.1 PRK00913 81..579 CDD:234863 13/38 (34%)

Return to query results.
Submit another query.