DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32061 and Dip-B

DIOPT Version :10

Sequence 1:NP_729611.1 Gene:CG32061 / 39196 FlyBaseID:FBgn0052061 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_650318.1 Gene:Dip-B / 48450 FlyBaseID:FBgn0000454 Length:508 Species:Drosophila melanogaster


Alignment Length:44 Identity:13/44 - (29%)
Similarity:18/44 - (40%) Gaps:1/44 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 GLFWHRSTSVTLIPYWSQIIGGGVSLEKASHLSGNCIS-IETHL 212
            ||..|...|:..|.|....|.|......|...:...:| ::|||
  Fly   463 GLDKHGLDSMLPIKYTHIDIAGSAGEHPAMPTAAPLVSLVKTHL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32061NP_729611.1 None
Dip-BNP_650318.1 Peptidase_M17 58..502 CDD:238247 10/38 (26%)

Return to query results.
Submit another query.