DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32061 and S-Lap2

DIOPT Version :10

Sequence 1:NP_729611.1 Gene:CG32061 / 39196 FlyBaseID:FBgn0052061 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_729394.1 Gene:S-Lap2 / 326209 FlyBaseID:FBgn0052351 Length:552 Species:Drosophila melanogaster


Alignment Length:61 Identity:14/61 - (22%)
Similarity:26/61 - (42%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 IGVWYSRHLQSGKSEVSMEKKGILKTTTTAAEQVKNNW-IKKQNSALKNGT-----LPRNI 124
            :|:|..:.|:..|..:|:....:..|.....:  ...| |..|.:|.:|.|     :|.|:
  Fly   180 LGIWIYQELRDPKRRISVPSIDLYATKDEICD--IEGWRIGLQKAAAQNLTRQLQEMPSNL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32061NP_729611.1 None
S-Lap2NP_729394.1 Peptidase_M17_N 54..189 CDD:426984 2/8 (25%)
Peptidase_M17 227..533 CDD:459978 3/12 (25%)

Return to query results.
Submit another query.