DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32061 and Npepl1

DIOPT Version :10

Sequence 1:NP_729611.1 Gene:CG32061 / 39196 FlyBaseID:FBgn0052061 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001365722.1 Gene:Npepl1 / 228961 MGIID:2448523 Length:529 Species:Mus musculus


Alignment Length:31 Identity:12/31 - (38%)
Similarity:16/31 - (51%) Gaps:9/31 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 RAIQLYGELQGLFWHRSTSVTLIPYWSQIIG 190
            |.:.|.|:||.|  ||      :| ||.:.|
Mouse    20 RPLLLLGQLQHL--HR------VP-WSHVRG 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32061NP_729611.1 None
Npepl1NP_001365722.1 Peptidase_M17 35..492 CDD:238247 4/8 (50%)

Return to query results.
Submit another query.