DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir7d

DIOPT Version :9

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:353 Identity:63/353 - (17%)
Similarity:129/353 - (36%) Gaps:93/353 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MELLYLNTL----------QSLSLLEGNRLVQTVQELN-NIYQTELNVFLEFGNGADILESAQGT 54
            ::.:::|.|          .|...::.:|::...|.|| |:|.....|.:...:..:...:|| .
  Fly    39 LQKIFINGLAVYNFGVFISTSYEEMDRDRVILVHQVLNRNLYPPNFPVAVVLASKMNRKITAQ-V 102

  Fly    55 FVPTLWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYDK 119
            |...|:::|.:....:........|.::.|.....:|.:                          
  Fly   103 FTQLLFVQNAEQAIAIAEGVNRNGLCVIVLLTSQPERPI-------------------------- 141

  Fly   120 LIQIFSRCFNEGF-VNVLVMLPGSDELYTF--MPYQDLKILNLKSIK------EFYSL-SRKKMD 174
            :.:||:....|.: :||::::|....:..|  .||......:|:.::      :.:.: .|:..:
  Fly   142 MTKIFTYFMQERYNINVVILVPRLHGVQAFNVRPYTPTSCSSLEPVEIDIKDGDLWDVFPRRLKN 206

  Fly   175 LNGYNITSGLVIAGAP-----RWFSFRDRQNRLILTGYMLRMI---VDFT-----NHFNGSV--- 223
            |:|..::  :::...|     .|.|.........|.|.:||::   ::||     |..||.:   
  Fly   207 LHGCPLS--VIVWDIPPYMRINWKSSDPMDGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGS 269

  Fly   224 RLMNVLTVNDGLELL----ANRTI-------DFFPFLIRPLKSFSMSNILYLENCGLIVPTSRPL 277
            ..||. |.....::|    ||.||       :...||........||.|:.|:..|       ..
  Fly   270 SFMNG-TFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVLQARG-------GY 326

  Fly   278 PNWVYLLRPYAFDTWIA--------WLI 297
            ..:..:|.|:...||:.        |::
  Fly   327 SIYEVMLFPFEKYTWLLLSTILGLHWIV 354



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.