DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir87a

DIOPT Version :9

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:522 Identity:106/522 - (20%)
Similarity:178/522 - (34%) Gaps:131/522 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NGGSYDKLIQIFSRC-FNEGFVNVLVMLPGSDELYTFMPYQDLKILNLKS--IKEFYSLSRKKMD 174
            |....:.:|:.|.|. |.:.|..   .|.|.....:|.|::.....|.:.  :.::|  ...:.|
  Fly   307 NSSEPEAIIEEFFRAKFEDKFPR---DLSGCPLTASFRPWEPYIFRNSEEQPVDDYY--YGLQGD 366

  Fly   175 LNGYNITSGLVIAGAPRWFSFRDRQ--------------------NRLILTGYMLRMIVDFTNHF 219
            .:.||.||       |.:....|..                    .:|.|:|....|:.......
  Fly   367 EDDYNDTS-------PNYGESDDESYADPGEDGDGAIPDTETQSGGKLKLSGIEYEMVQTIAERL 424

  Fly   220 NGSVRLMNVLTVNDGLELLANRTIDFFPFLI-------RPLKSFSMSNILYLEN----CGLIVPT 273
            :.|:.:..   .|..|..|..:.||....:|       ..:..|..|:|.|.::    |   |..
  Fly   425 HVSIEMQG---ENSNLYHLFQQLIDGEIEMIVGGIDEDPSISQFVSSSIPYHQDELTWC---VAR 483

  Fly   274 SRPLPNWVYLLRPYAFDTWIAWLIMLIYCS----LALRILSKGQISISAAFLKVLRLVMYLSG-- 332
            ::....:...:..:..|......|.::.||    ||.|:......:::..|...||::..|..  
  Fly   484 AKRRHGFFNFVATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQA 548

  Fly   333 --SRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWED----------- 384
              ::|.   |.|.|. ||.:....||..:|.|.:.|.|.........||:|.::           
  Fly   549 IPAQDF---PITLRQ-LFALSFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGT 609

  Fly   385 ------LDKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGF--- 440
                  |:|...|:           |.|.::.::...:|..|..........:..|..||.:   
  Fly   610 SEHVRHLNKDGEIF-----------KYIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQHSFYNPR 663

  Fly   441 --------FDRIDFALYQQKFLRFPIFRKFPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGI 497
                    |||.: :||  .:|...:..|..|||:|                .|..::.|.|||.
  Fly   664 IQRDRLYCFDRRE-SLY--VYLVTMLLPKKYHLLHQ----------------INPVIQHIIESGH 709

  Fly   498 YLK-MKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGLTLATVC-FLLELLIGY 560
            ..| .:|...|..|...:..:  |:...:..:.| ::...||  :.|||.|...| |..||.  |
  Fly   710 MQKWARDLDMRRMIHEEITRV--REDPFKALTFD-QFRGAIA--FSGGLLLVASCVFAFELC--Y 767

  Fly   561 AK 562
            .|
  Fly   768 VK 769

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir67bNP_648393.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 14/69 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.