DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir85a

DIOPT Version :9

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster


Alignment Length:330 Identity:65/330 - (19%)
Similarity:128/330 - (38%) Gaps:62/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 LIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSKGQISISAAFLKVLRLVMYL-SG 332
            :|||.::..|.:..:.|.:....|...|:.::..::...||..          :|.|:.|.| :|
  Fly   302 VIVPKAKTAPTFWNIFRSFGSLVWALILVSVLVANVFCYILKS----------EVGRVPMQLFAG 356

  Fly   333 SRDMGTRPTTR-------RLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDS 390
            :.   |.|.|:       |||| :.....|.::.:.:...|:|......|...||....|.:|..
  Fly   357 AL---TMPMTQIPPNHSIRLFL-IFWLYFGLLICSAFKGNLTSMMVFQPYLPDINQLGALARSHY 417

  Fly   391 IWPLIDVDIKTMEKLI----PDRTKLLKKIVPTLEADVDTYRRNLNTSCIHSGFFDRIDFALYQ- 450
            ...:....:|.::..:    ...:::.::::..  :|...|....|.. |...:.::...|.:| 
  Fly   418 HIIIRPRHVKHIQHFLTLGHKHESRIREQMLEV--SDTQMYEMMRNND-IRFAYLEKYHIARFQV 479

  Fly   451 ----QKFLRFPIFRKFP------HLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGI---YLKMK 502
                ...|..|:|....      |.:|..|      :|.|||...:..:|...|.|.   :.::.
  Fly   480 NSRVHMHLGRPLFHLMNSCLVPFHAVYIVP------YGSPYLGFLDSLIRSSHEFGFERYWDRIM 538

  Fly   503 DDAYRHGIQSGLLNLAFRDRHLEVKSND------VEYYYLIAGLWFGGLTLATVCFLLELLIGYA 561
            :.|:   |:|| :.:..|.|.   ..||      :::::.:..||..|:.:|.:....|.|....
  Fly   539 NSAF---IKSG-VKVVNRRRG---SGNDEPVVLKLQHFHAVFALWLVGIGMACIVLAWEHLTHNY 596

  Fly   562 KIKVT 566
            .:.||
  Fly   597 NLAVT 601



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.