DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir56b

DIOPT Version :9

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:422 Identity:89/422 - (21%)
Similarity:180/422 - (42%) Gaps:79/422 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 NITSGLVIA----GAPRWFSFRDRQNRLIL---TGYMLRMIVDFTNHFNGSVRLMNVLTVNDGLE 236
            ::.||::.:    ..|..|.|.:.|  .::   .|..:.::..|...::..:.|       |.||
  Fly     6 DLASGVIRSPYSFDIPHAFIFNETQ--FVVPKFCGPYMEIVKHFAEVYHYQLFL-------DSLE 61

  Fly   237 LLANRTI------------DFFPFLIRPLKSFSMSN-------ILYLENCGLIVPTSRPLPNWVY 282
            .|..:::            .....:|||.::....|       :..:.|| ::||.:..||.|:|
  Fly    62 SLPKKSVVEQDIISGKYNLSLHGVIIRPEETSDFFNATQHSYPLELMTNC-VMVPLAPELPKWMY 125

  Fly   283 LLRPYAFDTWIAWLIMLIYCSLALRIL-----SKGQISISAAFLKVLRLVMYLSGSRDMGTR--- 339
            ::.|.....|....:...|.:|.||.:     .....|.:...|..:.|:|: |.:.:|..:   
  Fly   126 MVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALLMF-SANMNMSVKLKH 189

  Fly   340 PTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEK 404
            .:.|.:..:.:|...||||||.:::.:::.....::.:.|:||.||..|            .:..
  Fly   190 ASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHS------------RLRI 242

  Fly   405 LIPDRTKLLKKI--VPTLEADVDTYRRNLNTSCIHSG--FFDRIDFALYQQKFLRFPIFRK---- 461
            :|.|  .||:::  :|..:|.:.:..|:.........  ||:|      |||.|..|.|..    
  Fly   243 VIHD--SLLEELRWLPVYQALLASPSRSYAYVVTQDAWLFFNR------QQKVLIQPYFHLSKVC 299

  Fly   462 FPHLLYQQPLQISAAFGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLNLAFRDRHLEV 526
            |..|....|:..:|:|.    ...|.|:..::::|::...::.|:|:..|:|...: |.|.: .|
  Fly   300 FGGLFNALPMASNASFA----DSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKV-FLDTY-PV 358

  Fly   527 KSNDVEYYYLIAGLWFGGLTLATVCFLLELLI 558
            :..::|::.....:...|:.::::.|.|||.|
  Fly   359 EPLNLEFFTTAWIVLSAGIPISSLAFCLELFI 390



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.