DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir94f

DIOPT Version :9

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster


Alignment Length:482 Identity:99/482 - (20%)
Similarity:188/482 - (39%) Gaps:152/482 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 TFMPYQDLKILNLK--------SIKEFYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRDRQNRLI 203
            |..||   |:.|||        ...|..::.||  .|||.....|||      |           
  Fly   174 TLFPY---KLGNLKGHPIRTVPDNSEPLTIVRK--TLNGSIAIDGLV------W----------- 216

  Fly   204 LTGYMLRMIVDFTNHFNG------------SVRLMNVLTVNDGLELLANRTIDFFPFLIRPLKSF 256
                  :.:::|..|.|.            |::|:.:      |:|:.|:|:|    :...|:.:
  Fly   217 ------QFMIEFAKHINATLQLPIEPHPEKSIKLVQI------LDLVRNQTVD----IAASLRPY 265

  Fly   257 SM-----SNILY-----LENCGLIVPTSRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSK 311
            |:     |..:|     :.|..:::||.|.:.:...|.| .....| .|||:|::.|:. |.|::
  Fly   266 SLNVQRSSTHIYGSPMMVGNWCMMLPTERVIGSHEALTR-LMKSPW-TWLILLLFYSVH-RFLAQ 327

  Fly   312 GQISISAAFLKVLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTNLYVAQLSSNSAAGLYE 376
             :..:.::.:.:::|::.||             |..|:             .||||:........
  Fly   328 -KTRLRSSLIHLIKLLINLS-------------LICFL-------------QAQLSAYFIGPQKV 365

  Fly   377 KQINTWEDLDKSDSIWPLIDVDIK-----TMEKLIPDRTKLLKK-IVPTLEADVDTYRRNLNTSC 435
            ..|:..:.:::|       .:.|:     .||..|..|::.... ::..|..|:..||.:|||| 
  Fly   366 NHISNMQQVEES-------GLKIRGMRGEFMEYPIDMRSRYASSFLLHDLFFDLAQYRNSLNTS- 422

  Fly   436 IHSGFFDRIDFALYQ--QKFLRFPIFRKFPHLLYQQPLQISAAFGRPYLQLFNW----------- 487
             :......:.:.||:  |:..|.|:||....:..|:            |.||:.           
  Fly   423 -YGYTVTSVKWELYKEAQRHFRRPLFRYSEEICVQK------------LSLFSLIQQSNCIYCYR 474

  Fly   488 ---FVRKIFESGIYLKMKDDAYRHGIQSG---LLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGLT 546
               |:.::.|:|:.......:|...:.:|   :.:|:...|...::..:.:...|:.|:   ||.
  Fly   475 SRIFILRMHEAGLIRLWYRRSYYVMVTAGRFPIGDLSTVHRAQPIRWTEWQNVVLLHGV---GLL 536

  Fly   547 LATVCFLLELLIGYAKIKVTISCKMNI 573
            .:.|.|::||.:.||.:     |..|:
  Fly   537 FSVVVFVIELTVHYANV-----CLNNL 558



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.