DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir94a

DIOPT Version :9

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster


Alignment Length:662 Identity:121/662 - (18%)
Similarity:231/662 - (34%) Gaps:192/662 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ELLYLNTLQSLSLLEG-------------NRLVQTVQELNNIYQTELNVFLEFGNGADILESAQG 53
            :|.::|....|.::.|             |||:|.|   :|....|....|...|.|:.  |.|.
  Fly     6 QLKFINIFLVLLIIYGSSDGTENQHEIFLNRLLQAV---HNERSVETLFLLHHSNLANC--SLQD 65

  Fly    54 TFVPTLWIKNPQNQKVMKGNFTSCTLTILYLEDEHLDRGLYYLANWLWEYHHLEVLIFFNGGSYD 118
                  |  ||.....::.|    .||:..:|...              .|:...|:.....||.
  Fly    66 ------W--NPPRIPTIRSN----ELTVFNVEKTF--------------NHNALALVCLMKNSYR 104

  Fly   119 KLIQIFSR---CFNEGFVNVLVMLPGSDELYTFMPYQDL--KILNLKSIKEFYSLSRKKMDLNGY 178
            :::...::   |..:..: :|::...||..:    .:|:  ::.||:.:.....:.::|     |
  Fly   105 EILNTLAKSFDCMRQERI-ILMIHRKSDSKF----IEDITHEVKNLQFLHLIVLIVQEK-----Y 159

  Fly   179 NITSGLVIAGAPRWFSFRDRQNRLILTGYMLR------------------------------MIV 213
            |   |.|.|...|..||.:...:.|...:.::                              |..
  Fly   160 N---GQVFASTLRLQSFPEPHFKRIRNVFAIQRIFYRPINFHGKVLNAIPNDIPILFVALNEMFT 221

  Fly   214 DFTNHFNGSVRLMNVLTVNDGLELLA-NRTIDFFPFLIRPLKSFSMSNILYLENCGLIVPTSRPL 277
            ::...:|.::|:.| .|:.:.:|:.. |..||.      .::..:..|.|:..|..:.:.:    
  Fly   222 EYARRYNSTLRIQN-RTIKEDIEITEDNYDIDM------KIQLHNSQNFLHHMNIAMDIGS---- 275

  Fly   278 PNWVYLLRPYAFD---------------TWIAWLIMLIYCSLALRILSKGQISISAAF------- 320
             |.:.:|.|.|.:               ||:|.|..:|:..:.:..     :.||..|       
  Fly   276 -NSLIILVPCATELRGLDIFKELGVRTLTWLALLFYIIFVLVEMLF-----VFISNRFNGRNFTM 334

  Fly   321 -----LKVLRLVMYLSGSRDMGTRPTTRRLFL-----FVILTTSGFILTNLYVAQLSSNSAAGLY 375
                 |..||.|..:.|.    |.|.:.|..|     ||.::..|.:....:..:|.|......|
  Fly   335 RYTNPLINLRAVRAILGQ----TSPISNRYSLSIQHFFVFMSLFGTLFGGFFDCKLRSFLTKRPY 395

  Fly   376 EKQINTWEDLDKSDSIWPLIDVDIKTMEKLIPDRTKLLKKIVPTLEADVDTYR---RNLNTSCI- 436
            ..||..:.:|.|| .:..::|   .|..:.|..            |.:.:.:|   .|:.|:.| 
  Fly   396 YSQIENFSELRKS-GVTVVVD---HTTRQFIEQ------------EINANFFRDEVPNVRTTTIQ 444

  Fly   437 ----HSGFFDRIDFALYQQKFLRFPIFR--------------KFPHLLYQQPLQISAAFGRPYLQ 483
                |...:|| .|| :....:.:..||              |...:|...||..|......:..
  Fly   445 ELINHVYSYDR-KFA-FVANSIPWRTFREEMKSINQKILCDSKNLTILENVPLTFSIRRNAIFSH 507

  Fly   484 LFNWFVRKIFESGI---YLKMKDDAYRHGIQSGLLNLAFRDRHLEVKSNDVEYYYLIAGLWFGGL 545
            ....|:....:||:   :.||.....|..|::.|.....:..||.:..:..::.:.:..:.:   
  Fly   508 HLRNFIINAADSGMITCWFKMAGKVIRKHIKTTLRESEQQPSHLPLSFDHFKWLWAVLCIAY--- 569

  Fly   546 TLATVCFLLELL 557
            .::.:.|::|:|
  Fly   570 VMSFMVFVMEIL 581



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.