DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67b and Ir7b

DIOPT Version :9

Sequence 1:NP_648393.1 Gene:Ir67b / 39194 FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:501 Identity:99/501 - (19%)
Similarity:163/501 - (32%) Gaps:208/501 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GNFTSCTLTILYLED--------------------------EHLD--RGLYYLANWLWEYHHLEV 108
            |||..|.||....||                          |:|:  .|||::       :..||
  Fly   205 GNFYGCLLTCATWEDMPYLVWRPDGSGSFVGIEGALLQFMAENLNFTVGLYWM-------NKEEV 262

  Fly   109 LIFFNGGSYDKLIQIFSRCFNE-------GF---VNVLVMLPGSDELYTFMPYQDLKILNLKSIK 163
            |     .::|:..:||...|..       ||   .:....:|.|...|.||.:    |:.:.:::
  Fly   263 L-----ATFDESGRIFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMSH----IMLVTNLQ 318

  Fly   164 EFYSLSRKKMDLNGYNITS------GLVIAGAPRWFSFRDRQNRLILTGYMLRMIVDFTNHF--- 219
            ..||...|.    .:..|.      |||                |||...:|.::|.:.:|.   
  Fly   319 SAYSAYEKL----SFPFTPLLWRAIGLV----------------LILACLLLMLLVRWRHHHELP 363

  Fly   220 -NGSVRLMNVLTVNDGLELLANRTI-DFFP---------FLIRPLKSFSMSNILYLENCGLIVPT 273
             |....|: |||:...||   :|.: ..||         |....|:|...|.:..|    |...|
  Fly   364 RNPYYELL-VLTMGGNLE---DRWVPQRFPSRLVLLTWLFATLVLRSGYQSGMYQL----LRQDT 420

  Fly   274 SRPLPNWVYLLRPYAFDTWIAWLIMLIYCSLALRILSKGQISISAAFLKVLRLVMYLSGS----- 333
            .|..|..:.             .::..:.::.|..:::.:|..|...|:..:|| ||.||     
  Fly   421 QRNPPQTIS-------------EVLAQHFTIQLAEVNEARILASLPELRPEQLV-YLEGSELQSF 471

  Fly   334 ----RDMGT-------------------RPTTRRLFL-----------FVI-------------- 350
                :..|:                   .|.:|||.|           |.:              
  Fly   472 PALAQQSGSSARVAILTPYEYFGYFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSHLVGVLNKQI 536

  Fly   351 --LTTSGFI--LTNLYVAQL--SSNSAAGLYEKQINTWEDLDKSDSI------------------ 391
              ..|.||:  .|..||:.:  ...|.|.:.....:|.:.:|...|:                  
  Fly   537 QHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLS 601

  Fly   392 --------WPLI-----DVDIKTMEKLIPDRTKLLKKIVPTLEADV 424
                    |.::     .|.:..:|.|:| |.| |:||:..:::|:
  Fly   602 MRELAALFWLILWANLGAVVVFVLELLLP-RIK-LRKILRKMKSDI 645



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.