DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and RNF144A

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001336110.1 Gene:RNF144A / 9781 HGNCID:20457 Length:318 Species:Homo sapiens


Alignment Length:227 Identity:70/227 - (30%)
Similarity:92/227 - (40%) Gaps:70/227 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 IPQLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGLANTIKCPAANC-----------E 189
            :.|:..|..|.|          .||..|.|||: .....|||...|.||.|.|           |
Human    29 VEQMTTIAQCQC----------IFCTLCLKQYV-ELLIKEGLETAISCPDAACPKQGHLQENEIE 82

  Fly   190 ILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVC-------AEPRAV 247
            .:|          .:|:::||::|.....|..:....||||..|    :|||       ..|:.|
Human    83 CMV----------AAEIMQRYKKLQFEREVLFDPCRTWCPASTC----QAVCQLQDVGLQTPQPV 133

  Fly   248 LCK-CGHEFCFACGENWHE-------------PASCSSLKKWVKKCLEDSETSNWIAQNTKECPK 298
            .|| |..|||..|..:||.             |...|:..|     :|:.:..      .|.|||
Human   134 QCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFK-----MEEDDAP------IKRCPK 187

  Fly   299 CNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330
            |.|.||:|.||..|:|||  |::.|||.||.|
Human   188 CKVYIERDEGCAQMMCKN--CKHAFCWYCLES 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 24/81 (30%)
IBR 273..331 CDD:279784 24/58 (41%)
RNF144ANP_001336110.1 mRING-HC-C4C4_RBR_RNF144A 19..72 CDD:319691 18/53 (34%)
modified RING-HC finger (C4C4-type) 20..70 CDD:319691 17/51 (33%)
IBR 91..156 CDD:214763 23/68 (34%)
IBR <177..216 CDD:307574 20/46 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.