DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and Sharpin

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_112415.1 Gene:Sharpin / 81859 RGDID:631353 Length:381 Species:Rattus norvegicus


Alignment Length:112 Identity:24/112 - (21%)
Similarity:36/112 - (32%) Gaps:21/112 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TCTEILLPENSNSPETEDFVYKVLSVDQIVQHQRNII---DEVNNVLNLPPQVTRIILNHFKWDK 95
            |..|:.||:.|.:          |..:::..|....|   ||     ....||..|:..|.....
  Rat   154 TQPEMDLPQGSGN----------LKKEELATHLAQAIAGGDE-----KAAAQVAAILAQHHVALN 203

  Fly    96 ESLFENYFESNPKDFFQRAHVLNPFEKKIERESAASTSCAIPQLCGI 142
            ..|.|.:|...|   .:....:......:...|:|..|..|...|.|
  Rat   204 VQLLEAWFPRGP---IRLQVTVEDATSVLSSSSSAHVSLQIHPHCSI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763
IBR 273..331 CDD:279784
SharpinNP_112415.1 Self-association. /evidence=ECO:0000269|PubMed:11178875 1..177 7/32 (22%)
Sharpin_PH 18..125 CDD:407032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..153
Interaction with SHANK1. /evidence=ECO:0000269|PubMed:11178875 172..305 18/84 (21%)
Ubl_HOIL1 215..299 CDD:340497 7/36 (19%)
zf-RanBP 346..370 CDD:395516
RanBP2-type Zn finger 346..365 CDD:275376
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.