Protein Alignment CG12362 and SHARPIN

DIOPT Version :9

• Sequence 1: NP_648392.1
• Gene: CG12362 / 39193
• FlyBaseID: FBgn0036082
• Length: 511
• Species: Drosophila melanogaster
• Sequence 2: NP_112236.3
• Gene: SHARPIN / 81858
• HGNCID: 25321
• Length: 387
• Species: Homo sapiens
• Alignment Length: 33
• Identity: 10/33 - (30%)
• Similarity: 13/33 - (39%)
• Gaps: 2/33 - (6%)

  Fly   291 QNTKECPKCNVTIEKD-GGCNHMVCKNPSCRYD 322
            |.:..||.|......| .||.....:.| |.:|
Human   349 QPSWSCPSCTFINAPDRPGCEMCSTQRP-CTWD 380

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG12362	NP_648392.1	IBR	208..269	CDD:214763
		IBR	273..331	CDD:279784	10/33 (30%)
SHARPIN	NP_112236.3	Self-association. /evidence=ECO:0000250|UniProtKB:Q9EQL9	1..180
		Sharpin_PH	29..126	CDD:293369
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	122..169
		Interaction with SHANK1. /evidence=ECO:0000250|UniProtKB:Q9EQL9	175..310
		UBQ	240..300	CDD:294102
		Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite	305..349		10/33 (30%)
		ZnF_RBZ	351..373	CDD:197784	6/21 (29%)
		RanBP2-type Zn finger	352..371	CDD:275376	6/18 (33%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1815
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900