DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and sharpin

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_001333481.5 Gene:sharpin / 793673 ZFINID:ZDB-GENE-101223-1 Length:394 Species:Danio rerio


Alignment Length:157 Identity:28/157 - (17%)
Similarity:58/157 - (36%) Gaps:21/157 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 SWEPHGSSWYSCN-RFDEEEAKQARLAQQKYRSSMARYLHYYNRYSNHMQSLKMENKLYSNIQAK 393
            |..|:.:..::.. |..:...:...||:...||..      |...|.....|::....:..:...
Zfish    33 SMNPNRAGLFTLTLRHTDRGGRSVSLAEFDLRSVQ------YELKSPRCHELRLLKPPHDCLSFS 91

  Fly   394 MDDMQEEMSW--IEVQFLRDAVDVLCQCRTTLMYSYVFAFYLMNNNQKIIFEDNQKDMEMATEKL 456
            ....||...|  :.:..||::..|...|:..|.       |:.:..:..:...:.|: |:..| |
Zfish    92 FRSEQEAQEWATVVMSSLRESHRVASICQEGLQ-------YVKSGEKSAVLSLSMKE-ELCVE-L 147

  Fly   457 SECLE---REITVKNIYEVKQKVLDLS 480
            |..:|   .:...:...::.|:.:.||
Zfish   148 SRAIEAGDAQAAARYATDLAQQQMTLS 174

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763