DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and Rnf19b

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001355692.1 Gene:Rnf19b / 75234 MGIID:1922484 Length:732 Species:Mus musculus


Alignment Length:228 Identity:64/228 - (28%)
Similarity:98/228 - (42%) Gaps:36/228 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ERESAASTSCAIPQLCGICFCSCDELIG---------LGCGHNFCAACWKQYLANKTCSEGLANT 180
            |.:.||....|....|.:|      |:.         |.|.|..|..|.:.||..:.....:  .
Mouse   101 EEDEAAEGGGAEEVECPLC------LVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRV--P 157

  Fly   181 IKCPAANCEILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAV-CAEP 244
            |.||  .|...::......|..|..::.:|::.:...::..:...||||||:|.:||.|. ||..
Mouse   158 ISCP--ECSERLNPHDIRLLLADPPLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASC 220

  Fly   245 RAVLCK---CGHEFCFACGENWHEPASCSSLKKWVKKCL--EDSETS-------NWIAQNTKECP 297
            ..:.|:   |..|||:.|.:.||...:|...::...:.|  ....||       :..|.:.|.||
Mouse   221 PKLTCEREGCQTEFCYHCKQIWHPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIKPCP 285

  Fly   298 KCNVTIEK--DGGCNHMVCKNPSCRYDFCWVCL 328
            :|:..|.|  ||.||||.|  ..|..:|||:|:
Mouse   286 RCSAYIIKMNDGSCNHMTC--AVCGCEFCWLCM 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 21/64 (33%)
IBR 273..331 CDD:279784 22/67 (33%)
Rnf19bNP_001355692.1 Required for ubiquitin ligase activity and for protection against staurosporin-induced cell death. /evidence=ECO:0000250|UniProtKB:Q6ZMZ0 1..315 63/225 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109 3/7 (43%)
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 112..334 60/217 (28%)
RING-HC_RBR_RNF19B 116..169 CDD:319690 14/62 (23%)
RING-HC finger (C3HC4-type) 116..163 CDD:319690 13/56 (23%)
IBR 184..248 CDD:214763 21/63 (33%)
IBR <280..318 CDD:307574 18/39 (46%)
AzlC <344..433 CDD:351157
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 598..644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 660..732
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.