DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf217

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001076322.1 Gene:rnf217 / 567287 ZFINID:ZDB-GENE-060503-400 Length:543 Species:Danio rerio


Alignment Length:420 Identity:96/420 - (22%)
Similarity:151/420 - (35%) Gaps:103/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNSEMEFSDEDH-GDSHRSLLTHMSCENDSDSEDTCTEILLPENSNSPETEDFVYKV--LSVDQI 62
            :.:::..:|.|| .|..|...:.::.:.|.:|.        ||..|........|.:  .|.:..
Zfish   109 VGNDINLNDLDHENDDERLQCSTINLQQDIESN--------PELGNPDGNHHIDYNIDLKSGEDP 165

  Fly    63 VQHQRNIIDEV----NNVLNLPPQVTRIILNHFKWDKESLFENYFESNPKDFFQRAHVLNPFE-- 121
            .|.:.::...|    |:...:|.|.|  ..||......|...:...|:|......:..|...|  
Zfish   166 SQSKEHVYCTVYCIANDNYRIPVQKT--TSNHETSSSSSSSSSSSSSSPDVLVLPSTDLPNLELD 228

  Fly   122 ----------------KKIERESAASTSCAIPQLCGICFCSCDELIGLGCGHN-FCAACWKQYLA 169
                            ..|.....|..|.::...|.||. ...:::.|.|... .|..|.|:|:.
Zfish   229 NHDPYPVPYTVSDLMVSGIHSSYNADNSLSVVLTCRICL-DDKQIMPLHCCKKAVCEECLKRYII 292

  Fly   170 NKTCSEGLANTIKCPAANC-----EILVDYISFLKLADDSEVVERYQQLITNTFVECNML-MRWC 228
            ::. ..|.|:.: ||...|     |.||  ||.|    .||.:.:|:.     |:|.:.| ....
Zfish   293 SQV-HVGRAHLV-CPITECSGFLEENLV--ISHL----TSEELAKYKY-----FLELSQLDSSTK 344

  Fly   229 PAPNCS-----------------HAVKAVCAEPRAVLCKCGHEFCFACGENWHEPASCSSLKKWV 276
            |.|.||                 |..|..|.       ||...:||.|...|||...|...:|  
Zfish   345 PCPQCSLFTSLRGRSQQSSTKSEHKYKIQCT-------KCQFVWCFKCHSPWHEGLKCRDYRK-- 400

  Fly   277 KKCLEDSETSNWIA------QNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVC------LG 329
                .|....:|.:      :|.::||:|.:.|::..||:||.|  ..|..:||:.|      |.
Zfish   401 ----GDKLLRHWASVIERGQRNAQKCPRCKIHIQRTEGCDHMTC--TQCSTNFCYRCGEKYRHLR 459

  Fly   330 SWEPHGS--SWYSCN-RFDEEEAKQARLAQ 356
            .:..|.|  |.:.|. |:..|:....||.:
Zfish   460 FFGDHTSNLSVFGCKYRYLPEKPHLRRLVR 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 19/78 (24%)
IBR 273..331 CDD:279784 18/69 (26%)
rnf217NP_001076322.1 IBR 328..395 CDD:214763 19/78 (24%)
IBR <417..455 CDD:279784 14/39 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.