DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf19b

DIOPT Version :10

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001189369.1 Gene:rnf19b / 562396 ZFINID:ZDB-GENE-060503-281 Length:701 Species:Danio rerio


Alignment Length:207 Identity:66/207 - (31%)
Similarity:98/207 - (47%) Gaps:26/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 CGICFC--SCDELIGL-GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLA 201
            |.:|..  ..::|..| ||.|..|..|.:|||..:.....:  .:.||.. .|.|..:...| :.
Zfish   107 CPLCLVRQPAEQLPELQGCSHRSCLCCLRQYLRIEITESRV--QLSCPEC-AERLAPWQVAL-IL 167

  Fly   202 DDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAV-CAEPRAVLCK---CGHEFCFACGEN 262
            ||..::|:|::.:....:..:...||||||:|..||.|. ||....::|:   ||.|||:.|.:.
Zfish   168 DDPNLMEKYEEFLLRRCLASDPDCRWCPAPDCGFAVIASGCASCPRLVCRREGCGAEFCYHCKQA 232

  Fly   263 WHEPASCSSLKKWVKKCLEDSETSNWIAQNT---------KECPKCNVTIEK--DGGCNHMVCKN 316
            ||...:|.|.::  ::.|.....||.....|         |.||:|...|.|  ||.||||.|  
Zfish   233 WHPNQTCDSARQ--QRALSLRTHSNHSPSYTAEQGHTDDIKPCPRCGAYIIKMNDGSCNHMTC-- 293

  Fly   317 PSCRYDFCWVCL 328
            ..|..:|||:|:
Zfish   294 AVCGCEFCWLCM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 RING-HC_RBR_HHARI 138..194 CDD:438288 16/56 (29%)
BRcat_RBR_HHARI-like 203..284 CDD:439004 27/84 (32%)
Rcat_RBR_HHARI-like 288..345 CDD:439017 19/52 (37%)
Ariadne 346..>480 CDD:466073
rnf19bNP_001189369.1 Required for ubiquitin ligase activity and for protection against staurosporin-induced cell death. /evidence=ECO:0000250|UniProtKB:Q6ZMZ0 1..304 65/204 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 103..323 66/207 (32%)
RING-HC_RBR_RNF19B 104..167 CDD:438432 17/63 (27%)
BRcat_Rcat_RBR 172..246 CDD:459240 25/75 (33%)
Rcat_RBR_RNF19 268..335 CDD:439016 18/40 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..677
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.