Sequence 1: | NP_648392.1 | Gene: | CG12362 / 39193 | FlyBaseID: | FBgn0036082 | Length: | 511 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189369.1 | Gene: | rnf19b / 562396 | ZFINID: | ZDB-GENE-060503-281 | Length: | 701 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 66/207 - (31%) |
---|---|---|---|
Similarity: | 98/207 - (47%) | Gaps: | 26/207 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 CGICFC--SCDELIGL-GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLA 201
Fly 202 DDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAV-CAEPRAVLCK---CGHEFCFACGEN 262
Fly 263 WHEPASCSSLKKWVKKCLEDSETSNWIAQNT---------KECPKCNVTIEK--DGGCNHMVCKN 316
Fly 317 PSCRYDFCWVCL 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12362 | NP_648392.1 | IBR | 208..269 | CDD:214763 | 23/64 (36%) |
IBR | 273..331 | CDD:279784 | 22/67 (33%) | ||
rnf19b | NP_001189369.1 | Required for ubiquitin ligase activity and for protection against staurosporin-induced cell death. /evidence=ECO:0000250|UniProtKB:Q6ZMZ0 | 1..304 | 65/204 (32%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..97 | ||||
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 | 103..323 | 66/207 (32%) | |||
IBR | 174..239 | CDD:214763 | 23/64 (36%) | ||
IBR | <269..307 | CDD:279784 | 18/39 (46%) | ||
TauE | <329..>421 | CDD:280159 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 472..495 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 658..677 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |