DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf19b

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001189369.1 Gene:rnf19b / 562396 ZFINID:ZDB-GENE-060503-281 Length:701 Species:Danio rerio


Alignment Length:207 Identity:66/207 - (31%)
Similarity:98/207 - (47%) Gaps:26/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 CGICFC--SCDELIGL-GCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCEILVDYISFLKLA 201
            |.:|..  ..::|..| ||.|..|..|.:|||..:.....:  .:.||.. .|.|..:...| :.
Zfish   107 CPLCLVRQPAEQLPELQGCSHRSCLCCLRQYLRIEITESRV--QLSCPEC-AERLAPWQVAL-IL 167

  Fly   202 DDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAV-CAEPRAVLCK---CGHEFCFACGEN 262
            ||..::|:|::.:....:..:...||||||:|..||.|. ||....::|:   ||.|||:.|.:.
Zfish   168 DDPNLMEKYEEFLLRRCLASDPDCRWCPAPDCGFAVIASGCASCPRLVCRREGCGAEFCYHCKQA 232

  Fly   263 WHEPASCSSLKKWVKKCLEDSETSNWIAQNT---------KECPKCNVTIEK--DGGCNHMVCKN 316
            ||...:|.|.::  ::.|.....||.....|         |.||:|...|.|  ||.||||.|  
Zfish   233 WHPNQTCDSARQ--QRALSLRTHSNHSPSYTAEQGHTDDIKPCPRCGAYIIKMNDGSCNHMTC-- 293

  Fly   317 PSCRYDFCWVCL 328
            ..|..:|||:|:
Zfish   294 AVCGCEFCWLCM 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 23/64 (36%)
IBR 273..331 CDD:279784 22/67 (33%)
rnf19bNP_001189369.1 Required for ubiquitin ligase activity and for protection against staurosporin-induced cell death. /evidence=ECO:0000250|UniProtKB:Q6ZMZ0 1..304 65/204 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 103..323 66/207 (32%)
IBR 174..239 CDD:214763 23/64 (36%)
IBR <269..307 CDD:279784 18/39 (46%)
TauE <329..>421 CDD:280159
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.