DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf19a

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001313624.1 Gene:rnf19a / 557995 ZFINID:ZDB-GENE-030131-9414 Length:913 Species:Danio rerio


Alignment Length:354 Identity:94/354 - (26%)
Similarity:144/354 - (40%) Gaps:85/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PENSNSPE-----TEDFVYKVLSVDQIVQHQ------RNIIDEVNNVLNLP-----PQVTRIILN 89
            |.:|:||.     ::.|.....|..::..||      |::....::| :||     |:..||.| 
Zfish    66 PSSSSSPSLPVDTSQSFGNHSASFGEMSLHQQQQGSERDLPSAASSV-SLPSVRKTPKKRRISL- 128

  Fly    90 HFKWDKESLFENYFESNPKDFFQR---------AHVLNPFEKKIERESAASTSCAIPQLCGICF- 144
                  .|||.... .:||....|         |.|.:...:..:::..||...|    .|:.: 
Zfish   129 ------RSLFRRRC-GDPKSRKSRALAAGVDGIASVESVHSEMCQQQDHASALSA----AGVAYT 182

  Fly   145 -CSCDELIG-----------------------LGCGHNFCAACWKQYLANKTCSEGLANTIKCPA 185
             .||....|                       :.|.|..||.|.:|||..: .||...| |.|| 
Zfish   183 SSSCSSSSGSTSELLECPLCLLRHTRDRFPDIMTCHHRSCADCLRQYLRIE-ISESRVN-ISCP- 244

  Fly   186 ANCEILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAV-CAEPRAVLC 249
             .|....:......:.:|..::|:|::.:...::..:...||||||:|.:||.|. ||....:.|
Zfish   245 -ECSERFNPHDIRMILNDRVLMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKITC 308

  Fly   250 ---KCGHEFCFACGENWHEPASCSS----------LKKWVKKCLEDSETSNWIAQNTKECPKCNV 301
               .||.|||:.|.:.||...:|.:          |:.:....|..|:.|...|.:.|.||:|..
Zfish   309 GRDGCGTEFCYHCKQLWHPNQTCDAARQQRAQSLRLRPFRSSSLSYSQESGAAADDIKPCPRCAA 373

  Fly   302 TIEK--DGGCNHMVCKNPSCRYDFCWVCL 328
            .|.|  ||.||||.|  ..|..:|||:|:
Zfish   374 YIIKMNDGSCNHMTC--AVCGCEFCWLCM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 23/64 (36%)
IBR 273..331 CDD:279784 22/58 (38%)
rnf19aNP_001313624.1 IBR 266..331 CDD:214763 23/64 (36%)
IBR <364..402 CDD:279784 18/39 (46%)
AzlC <428..517 CDD:294385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.