DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and RNF31

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_060469.4 Gene:RNF31 / 55072 HGNCID:16031 Length:1072 Species:Homo sapiens


Alignment Length:430 Identity:80/430 - (18%)
Similarity:146/430 - (33%) Gaps:124/430 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HGDSHRSLLTHMSCEN---------DSDSEDTCTEILLPENSNSPETEDFVYKVLSVDQIVQHQR 67
            ||......||.:..:.         ||..|.|       .:.:.|:.:..|.::|:         
Human   601 HGGDVSRALTELQRQRLEPFRQRLWDSGPEPT-------PSWDGPDKQSLVRRLLA--------- 649

  Fly    68 NIIDEVNNVLNLPPQVTRIILNHFKWDKESLFENYFESNPKDFFQRAHVL--------NPFEKKI 124
                    |..||           .|.:..|..:..:..|:: ::...|:        ..|.:::
Human   650 --------VYALP-----------SWGRAELALSLLQETPRN-YELGDVVEAVRHSQDRAFLRRL 694

  Fly   125 ERESAASTSCAIP--QLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGLANTIKCPAAN 187
            ..:..|....|:|  ::..:..|.|          ..|..|::|:.......:.:.:.: |||..
Human   695 LAQECAVCGWALPHNRMQALTSCEC----------TICPDCFRQHFTIALKEKHITDMV-CPACG 748

  Fly   188 CEILVD---YISFLKLAD-------DSEVVERYQQLITNTFVECNMLMR-----WCPAPNCS--- 234
            ...|.|   .:|:....|       :.:....:.:.:|.     .:|||     ||  ..||   
Human   749 RPDLTDDTQLLSYFSTLDIQLRESLEPDAYALFHKKLTE-----GVLMRDPKFLWC--AQCSFGF 806

  Fly   235 ----HAVKAVCAEPRAVLCKCGHEFCFACGENW---HEPASCSSLKKWVKKCLEDSE-----TSN 287
                ..::|.|.:       |...||..|...|   |...||...:.|  |.:.|.|     .:.
Human   807 IYEREQLEATCPQ-------CHQTFCVRCKRQWEEQHRGRSCEDFQNW--KRMNDPEYQAQGLAM 862

  Fly   288 WIAQNTKECPKCNVTIE-KDGGCNHMVCKNPSCRYDFCWVCLGSWEPHGSSWYSCNRFDEEEAKQ 351
            ::.:|..:||||..:.. ..|||.|..|  ..||:.||..|.       :::|:.|:..|...:.
Human   863 YLQENGIDCPKCKFSYALARGGCMHFHC--TQCRHQFCSGCY-------NAFYAKNKCPEPNCRV 918

  Fly   352 ARLAQQKYRSSMARYLHYYNRYSNHMQSLKMENKLYSNIQ 391
            .:.....:......||..:.  :..:|.|..:|.:..|.:
Human   919 KKSLHGHHPRDCLFYLRDWT--ALRLQKLLQDNNVMFNTE 956

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 16/75 (21%)
IBR 273..331 CDD:279784 19/63 (30%)
RNF31NP_060469.4 Polyubiquitin-binding 1..485
PUB_RNF31 52..153 CDD:198422
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..290
RanBP2-type Zn finger 304..323 CDD:275376
RanBP2-type Zn finger 354..373 CDD:275376
RanBP2-type Zn finger 413..432 CDD:275376
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..484
HOIP-UBA 483..627 CDD:293283 4/25 (16%)
Interaction with RBCK1 563..616 4/14 (29%)
UBA_RNF31 571..625 CDD:270510 4/23 (17%)
TRIAD supradomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01221 695..929 55/269 (20%)
NMD3 699..>749 CDD:282790 11/60 (18%)
IBR 779..841 CDD:214763 16/75 (21%)
LDD domain 910..1072 7/49 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.