DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and Rnf144a

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001075879.1 Gene:Rnf144a / 500636 RGDID:1561737 Length:292 Species:Rattus norvegicus


Alignment Length:225 Identity:72/225 - (32%)
Similarity:91/225 - (40%) Gaps:70/225 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGLANTIKCPAANC-----------EIL 191
            |:..|..|.|          .||..|.|||: .....|||...|.||.|.|           |.:
  Rat    31 QMTTIAQCQC----------IFCTLCLKQYV-ELLIKEGLETAISCPDAACPKQGHLQENEIECM 84

  Fly   192 VDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVC-------AEPRAVLC 249
            |          .:|:::||::|.....|..:....||||..|    :|||       ..|:.|.|
  Rat    85 V----------AAEIMQRYKKLQFEREVLFDPCRTWCPASTC----QAVCQLQDIGLQTPQLVQC 135

  Fly   250 K-CGHEFCFACGENWHE-------------PASCSSLKKWVKKCLEDSETSNWIAQNTKECPKCN 300
            | |..|||.||...||.             |...||..|     :|:.:..      .|.||||.
  Rat   136 KACDMEFCSACKARWHPGQGCPETMPISFLPGETSSAFK-----VEEGDAP------IKRCPKCR 189

  Fly   301 VTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330
            |.||:|.||..|:|||  |::.|||.||.|
  Rat   190 VYIERDEGCAQMMCKN--CKHAFCWYCLES 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 25/81 (31%)
IBR 273..331 CDD:279784 24/58 (41%)
Rnf144aNP_001075879.1 mRING-HC-C4C4_RBR_RNF144A 19..72 CDD:319691 18/51 (35%)
IBR 91..156 CDD:214763 24/68 (35%)
IBR <179..216 CDD:396187 20/44 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.