DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf144ab

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_005160733.1 Gene:rnf144ab / 437000 ZFINID:ZDB-GENE-040718-486 Length:294 Species:Danio rerio


Alignment Length:234 Identity:72/234 - (30%)
Similarity:104/234 - (44%) Gaps:43/234 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 FEKKIERESAASTSC-------AIPQLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGL 177
            :|...:.:.|...||       .:.|:..|..|.|          .||:.|.|||: .....|||
Zfish     6 YEPSWDVDLAPLLSCKLCLGEFPLEQMTTISQCQC----------IFCSLCLKQYV-ELLIKEGL 59

  Fly   178 ANTIKCPAANC----EILVDYISFLKLADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVK 238
            ...|.||.:.|    .:|.:.|..:..   .||::.|::|.....|..:....|||:.:|    :
Zfish    60 ETAISCPDSTCPKQGHLLENEIECMVA---GEVMQHYKRLQFEREVLLDPCRTWCPSSSC----Q 117

  Fly   239 AVC----AE---PRAVLC-KCGHEFCFACGENWHEPASCSSLKKWVKKCLEDSETSNWIAQN--- 292
            |||    ||   |:.|.| :|...||.||..:.|...:|..:.........::.:||..:|.   
Zfish   118 AVCQLNEAEVQLPQPVQCPECSLRFCSACRADCHTGQACQEMLPITTFLPGENGSSNLKSQEDEA 182

  Fly   293 -TKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVCLGS 330
             .|.||||.|.||:|.||..|:|||  |::.|||.||.|
Zfish   183 PIKRCPKCKVYIERDEGCAQMMCKN--CKHAFCWYCLES 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 21/68 (31%)
IBR 273..331 CDD:279784 25/62 (40%)
rnf144abXP_005160733.1 IBR 93..156 CDD:214763 21/66 (32%)
IBR <179..218 CDD:279784 20/40 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.