DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rbck1

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001002168.1 Gene:rbck1 / 431715 ZFINID:ZDB-GENE-040704-3 Length:515 Species:Danio rerio


Alignment Length:270 Identity:59/270 - (21%)
Similarity:105/270 - (38%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 ENYFESNPKDFFQRAHVLNPFEKKIERESAASTSCAIPQLCGICFCSCDELIGLG-----CGHNF 159
            ::..:...::|.:|.   ..:|:.::.::.:.........|.|||.:.  :.|.|     |.|:|
Zfish   250 QSLLQEEERNFLERQ---RNYEELLQTDAHSLVGNTDQLECAICFGTI--MPGEGAVLRECLHSF 309

  Fly   160 CAACWKQYLANKTCSEGLANTIKCP------AANCEILVDYISFLKLADDSEVVERYQQLITNTF 218
            |..|.|..:.|...:|     :.||      |.||::....|..|...|:   .:::.:|..|..
Zfish   310 CRDCLKGTVVNCLDAE-----VCCPYGDNAYACNCKLQDREIKSLLTQDE---YQKFLELRLNIA 366

  Fly   219 VECNMLMRWCPAPNCS---------HAVKA-VCAEPRAVLCKCGHEFCFACGENWHE-------- 265
            ...:.....|..|:|:         :..|. :|.|...:|||..|:     |.|..|        
Zfish   367 ESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIHK-----GMNCKEYQDDLRVR 426

  Fly   266 ---PASCSSLKKWVKKCLEDSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRYDFCWVC 327
               ..:.....:.:.:.|::.|..|        ||||.|.::|..||:.:.|.  .|:.:.|||.
Zfish   427 AQNDEAARQTTEMLDQLLKNGEAMN--------CPKCQVIVQKKDGCDWICCL--MCKTEICWVT 481

  Fly   328 -LGSWEPHGS 336
             ...|.|.|:
Zfish   482 KQARWGPLGA 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 15/81 (19%)
IBR 273..331 CDD:279784 16/58 (28%)
rbck1NP_001002168.1 UBQ 62..136 CDD:320785
RanBP2-type Zn finger 195..214 CDD:275376
RING_Ubox 283..337 CDD:327409 16/60 (27%)
IBR 356..409 CDD:307574 10/52 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.