DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and park

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_730600.1 Gene:park / 40336 FlyBaseID:FBgn0041100 Length:482 Species:Drosophila melanogaster


Alignment Length:347 Identity:90/347 - (25%)
Similarity:128/347 - (36%) Gaps:111/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PETEDFVYKVLSVDQIVQHQRNI-IDEVNNVLNLPPQVTRIILNHFKWDKESLFENYF------- 103
            ||..|   .||...:|..|..:: :..|:|....||                 |..:|       
  Fly   192 PECWD---DVLKSRRIPGHCESLEVACVDNAAGDPP-----------------FAEFFFKCAEHV 236

  Fly   104 ESNPKDFFQRAHVLNPFEKKIERESAASTSCAIPQLCGICFCSCDELIGLGCG--HNFCAACWKQ 166
            ....|||   |..||..:..|:.         :|  |..|....|.::...|.  |..|..|::.
  Fly   237 SGGEKDF---AAPLNLIKNNIKN---------VP--CLACTDVSDTVLVFPCASQHVTCIDCFRH 287

  Fly   167 YLANKTCSEGLAN-----------TIKCPAANCE-ILVDYISFLKLADDSEVVERYQQLITNTFV 219
            |     |...|..           |:.|| |.|| ..::.|...||....| .:|||:..|..:|
  Fly   288 Y-----CRSRLGERQFMPHPDFGYTLPCP-AGCEHSFIEEIHHFKLLTREE-YDRYQRFATEEYV 345

  Fly   220 -ECNMLMRWCPAPNCSHAVKAVCAEP--RAVLCK--CGHEFCFACGENWHEPASCSSLKKWVKKC 279
             :...::  ||.|.|.   ..:..||  |.|.|:  ||:.||..|.:.:|           :.:|
  Fly   346 LQAGGVL--CPQPGCG---MGLLVEPDCRKVTCQNGCGYVFCRNCLQGYH-----------IGEC 394

  Fly   280 LED------------------------SETSN-WIAQNTKECPKCNVTIEKDGGCNHMVCKNPSC 319
            |.:                        .|.|| .|..:||.||||....|:||||.||||....|
  Fly   395 LPEGTGASATNSCEYTVDPNRAAEARWDEASNVTIKVSTKPCPKCRTPTERDGGCMHMVCTRAGC 459

  Fly   320 RYDFCWVCLGSW--EPHGSSWY 339
            .:::||||...|  :..|:.|:
  Fly   460 GFEWCWVCQTEWTRDCMGAHWF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 20/65 (31%)
IBR 273..331 CDD:279784 26/82 (32%)
parkNP_730600.1 UBQ 30..97 CDD:214563
parkin_N 32..101 CDD:176393
IBR 334..390 CDD:214763 19/60 (32%)
IBR <435..471 CDD:279784 18/35 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446172
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.