DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12362 and rnf144b

DIOPT Version :9

Sequence 1:NP_648392.1 Gene:CG12362 / 39193 FlyBaseID:FBgn0036082 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_957431.2 Gene:rnf144b / 394112 ZFINID:ZDB-GENE-040426-1292 Length:312 Species:Danio rerio


Alignment Length:202 Identity:64/202 - (31%)
Similarity:90/202 - (44%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 QLCGICFCSCDELIGLGCGHNFCAACWKQYLANKTCSEGLANTIKCPAANCE---ILVDYISFLK 199
            :.|.:..|||          .|||.|.:||: ......|..:.|.||...|:   .|:|  |.|.
Zfish    41 ETCTLQSCSC----------VFCAQCLRQYV-QLAIRAGAGSAITCPDPACKNSGTLLD--SELA 92

  Fly   200 LADDSEVVERYQQLITNTFVECNMLMRWCPAPNCSHAVKAVCA-------EPRAVLCK-CGHEFC 256
            ....|:.||.||:|.....|:.:....|||...|    :|||:       .|..|.|. |...||
Zfish    93 SFAPSDQVELYQRLRFERGVQLDPSKAWCPVLAC----QAVCSVTPGTEGTPVPVPCPVCQTVFC 153

  Fly   257 FACGENWHEPASCSSLKKWVKKCLEDSETSNWIAQNTKECPKCNVTIEKDGGCNHMVCKNPSCRY 321
            ..|...|.:..|||..:..:....:.:.:|:......|:||.|.|.||::.||..|:||  ||::
Zfish   154 CCCRSPWSDGHSCSLQQPLMPPLPDGALSSDDTEAAIKQCPVCGVYIERNQGCAQMLCK--SCKH 216

  Fly   322 DFCWVCL 328
            .|||.||
Zfish   217 TFCWYCL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12362NP_648392.1 IBR 208..269 CDD:214763 20/68 (29%)
IBR 273..331 CDD:279784 20/56 (36%)
rnf144bNP_957431.2 IBR 101..166 CDD:214763 20/68 (29%)
IBR <185..225 CDD:279784 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.